BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_I18 (475 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6G9.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr ... 27 1.9 SPAC19G12.16c |adg2|SPAC23A1.01c, mug46|conserved fungal protein... 25 5.9 SPAC13G7.08c |crb3||WD repeat protein Crb3|Schizosaccharomyces p... 25 7.8 SPBC13E7.01 |cwf22|SPBC15D4.16|splicing factor Cwf22|Schizosacch... 25 7.8 >SPAC6G9.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 681 Score = 26.6 bits (56), Expect = 1.9 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -3 Query: 278 SKNFLFTCGSPFYNNASSCQTSL 210 SKNF FT GS NN+++ +S+ Sbjct: 217 SKNFAFTSGSSSTNNSTTSSSSM 239 >SPAC19G12.16c |adg2|SPAC23A1.01c, mug46|conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 670 Score = 25.0 bits (52), Expect = 5.9 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -3 Query: 278 SKNFLFTCGSPFYNNASSCQTSL 210 S +F T GSP+YN +S +S+ Sbjct: 211 SSSFTTTTGSPYYNTSSFLPSSV 233 >SPAC13G7.08c |crb3||WD repeat protein Crb3|Schizosaccharomyces pombe|chr 1|||Manual Length = 446 Score = 24.6 bits (51), Expect = 7.8 Identities = 11/36 (30%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -1 Query: 289 KCEIAKI-FYSLVDLHFIIMRLAVKRRYIN*FIGTC 185 +C++ KI FYS L F +++ + Y+N + C Sbjct: 345 QCKVDKISFYSNSSLSFPVLKRMITNEYLNSDVRIC 380 >SPBC13E7.01 |cwf22|SPBC15D4.16|splicing factor Cwf22|Schizosaccharomyces pombe|chr 2|||Manual Length = 834 Score = 24.6 bits (51), Expect = 7.8 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +3 Query: 111 HTALILHELILNRLILNIGYIKTTL 185 HT + +H+ L + ++N+G++ TL Sbjct: 802 HTTVNIHQRYLEKGLMNLGHLHLTL 826 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,634,260 Number of Sequences: 5004 Number of extensions: 29015 Number of successful extensions: 51 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 182448900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -