BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_I17 (466 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) 151 3e-37 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 31 0.47 SB_53959| Best HMM Match : 7tm_1 (HMM E-Value=0.016) 31 0.62 SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) 30 0.82 SB_40632| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 29 2.5 SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) 27 5.8 SB_47345| Best HMM Match : Neural_ProG_Cyt (HMM E-Value=8.3) 27 5.8 SB_43496| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.8 SB_35937| Best HMM Match : LRR_1 (HMM E-Value=7.1e-09) 27 5.8 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 27 5.8 SB_1011| Best HMM Match : 7tm_2 (HMM E-Value=2e-40) 27 7.7 SB_640| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 >SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) Length = 157 Score = 151 bits (366), Expect = 3e-37 Identities = 75/117 (64%), Positives = 93/117 (79%) Frame = +1 Query: 10 FKMSTKILKAGAIEPDTFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIII 189 F S KI+K + FE ISQA++ELE NSD+KAQLRELYI+ AKEI++ KK+III Sbjct: 5 FTASAKIVKPQGETANEFEQGISQAILELEMNSDMKAQLRELYISSAKEIDVGGKKAIII 64 Query: 190 YVPMPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRS 360 +VP+P+++AFQKIQ RLVRELEKKFSGKHVV V R+ILP+P+ K+R KQKRPRS Sbjct: 65 FVPVPQIRAFQKIQTRLVRELEKKFSGKHVVIVAQRRILPRPTRKSR-NQKQKRPRS 120 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 31.1 bits (67), Expect = 0.47 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 8/94 (8%) Frame = +1 Query: 103 NSDLKAQLRELYITKAKEIE---LHNKKSIIIYVPMPKLKAFQKIQIRLVRELEKKFS-- 267 + + K L+E+ I ++K+ E + + KS PKLKA Q + + KK Sbjct: 261 HEEKKEDLKEVVIKQSKQDEATAIKDSKSESKPASKPKLKAVQNDAPKKANKPAKKAKKP 320 Query: 268 ---GKHVVFVGDRKILPKPSHKTRVANKQKRPRS 360 K V+ LP+ +H+ AN Q+RP++ Sbjct: 321 VKRAKKVLNKKKMDTLPRGAHRPASANAQRRPQN 354 >SB_53959| Best HMM Match : 7tm_1 (HMM E-Value=0.016) Length = 185 Score = 30.7 bits (66), Expect = 0.62 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -1 Query: 355 GAFSVCWLHVSCGWAWAGSYGH 290 GAF VCWL S G +W + GH Sbjct: 105 GAFVVCWLPYSIGTSWKLATGH 126 >SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) Length = 1552 Score = 30.3 bits (65), Expect = 0.82 Identities = 18/75 (24%), Positives = 39/75 (52%), Gaps = 4/75 (5%) Frame = +1 Query: 10 FKMSTKILKAGAIEP---DTFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKS 180 ++ K ++ G + P + ++T ++ L + L+ +RELY +E E KKS Sbjct: 153 YQFMKKCVQEGPVTPMAQEQWDTILTMIPARLVQSPQLQPYIRELYAEVKQEYEASIKKS 212 Query: 181 IIIYVPM-PKLKAFQ 222 ++ ++ + PK+K + Sbjct: 213 MVQHILVKPKVKGVE 227 >SB_40632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +2 Query: 212 RHSKRSKSGLSVS*KRSSAVSMLCS 286 RH RS+S L + K+S AV++LCS Sbjct: 574 RHRSRSRSRLEIVSKKSPAVNVLCS 598 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 28.7 bits (61), Expect = 2.5 Identities = 29/88 (32%), Positives = 45/88 (51%), Gaps = 5/88 (5%) Frame = +1 Query: 97 ETNSDLKAQLRE----LYITKAKEIELHNKKSIIIYVPMPKLKAFQKIQIRLVRELEKKF 264 E N+ LK +L E L +T+ +E E+ N K + +YV M KL++ Q ELEK+ Sbjct: 1699 EDNAILKRKLDEKETALKVTQDREREM-NDKLMALYVNMSKLESTQGTLEEKNAELEKE- 1756 Query: 265 SGKHVVFVGDRKILP-KPSHKTRVANKQ 345 ++ ++I P K S T VA + Sbjct: 1757 -----LYSAQQEIQPLKDSFNTAVAENE 1779 >SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) Length = 591 Score = 27.5 bits (58), Expect = 5.8 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +1 Query: 55 DTFETSISQALVELETNSDLKAQLRELYITKAKE-IELHNKKSIII 189 +T + + + +LE D KAQL EL + KAKE L KS + Sbjct: 224 ETLQEQEKETIQQLE--EDFKAQLNELEVEKAKEQTALEEMKSFTV 267 >SB_47345| Best HMM Match : Neural_ProG_Cyt (HMM E-Value=8.3) Length = 151 Score = 27.5 bits (58), Expect = 5.8 Identities = 11/26 (42%), Positives = 21/26 (80%) Frame = +1 Query: 193 VPMPKLKAFQKIQIRLVRELEKKFSG 270 VP+P++ A QK++ +L R++E+K +G Sbjct: 69 VPLPQVSAMQKVKGKL-RDMEQKLNG 93 >SB_43496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 380 Score = 27.5 bits (58), Expect = 5.8 Identities = 20/97 (20%), Positives = 47/97 (48%), Gaps = 8/97 (8%) Frame = +1 Query: 58 TFETSISQALVELETNSDLKAQLRELYITKAKEI-----ELHNKKSIIIYVPMPKLKAFQ 222 T + Q E++T+ + K +RE ITK K + E +++++ + K+ Sbjct: 241 TLSDAAKQCSTEIKTSENKKMTIREDMITKRKHVRDRRREHREEETVLRKDELDKVAKLY 300 Query: 223 KIQIRLVRELEKKF---SGKHVVFVGDRKILPKPSHK 324 + + + +RE+E++F K+ + +R++ + K Sbjct: 301 EEEKQDLREMEQEFQNMEAKYNAILEERRLAAEAEKK 337 >SB_35937| Best HMM Match : LRR_1 (HMM E-Value=7.1e-09) Length = 224 Score = 27.5 bits (58), Expect = 5.8 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = -3 Query: 383 SYTEVSVLERGLFCLLATRVLWLGLGRILRSPTNTTCLPLNFFSNSRTSLIWIFW 219 SY +S + + L A R L L ++ P +T LPL +F S + +FW Sbjct: 60 SYNRLSFIPADIGKLRALRELNLEGNQLGAMPISTLFLPLKYFRISNNFIHPLFW 114 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 27.5 bits (58), Expect = 5.8 Identities = 20/91 (21%), Positives = 41/91 (45%) Frame = +1 Query: 31 LKAGAIEPDTFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPMPKL 210 LKA T ET S E E ++ RE+ + ++ H+++ + L Sbjct: 35 LKASQFRKLTRETGASVLRNERERSAKRAQAFREISPSSPQDRRKHSERRPFLATECDNL 94 Query: 211 KAFQKIQIRLVRELEKKFSGKHVVFVGDRKI 303 + +K + +++RE+ KK + +G+ +I Sbjct: 95 QEAEKWRHQIIREVAKKVAQIQNAGLGEFRI 125 >SB_1011| Best HMM Match : 7tm_2 (HMM E-Value=2e-40) Length = 406 Score = 27.1 bits (57), Expect = 7.7 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 373 KSVSWNGAFSVCWLHVSCGWAWA 305 K ++GA + CWL V G WA Sbjct: 260 KGYGYHGAQTACWLSVDNGLIWA 282 >SB_640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 27.1 bits (57), Expect = 7.7 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 292 DRKILPKPSHKTRVANKQKRPRSRTLTSVYDAILED 399 D I+P P H+T N +K L S+ D +D Sbjct: 434 DELIIPPPRHRTETHNDEKFNVEERLRSLLDVAADD 469 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,845,440 Number of Sequences: 59808 Number of extensions: 306385 Number of successful extensions: 1011 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 934 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1009 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 957531822 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -