BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_I17 (466 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7... 229 3e-62 AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 23 5.3 EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 23 6.9 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 23 6.9 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 23 6.9 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 23 6.9 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 23 6.9 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 23 6.9 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 23 6.9 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 23 6.9 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 23 6.9 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 23 6.9 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 23 6.9 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 23 6.9 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 23 6.9 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 23 6.9 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 23 6.9 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 23 6.9 EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. 23 6.9 EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. 23 6.9 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 23 6.9 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 23 6.9 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 23 6.9 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 23 6.9 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 23 6.9 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 23 6.9 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 23 6.9 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 23 6.9 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 23 6.9 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 23 6.9 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 23 6.9 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 23 6.9 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 23 6.9 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 23 6.9 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 23 6.9 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 23 6.9 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 23 6.9 AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. 23 6.9 AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. 23 6.9 AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. 23 6.9 AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. 23 6.9 AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. 23 6.9 AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. 23 6.9 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 6.9 DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 22 9.2 >L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7 protein. Length = 192 Score = 229 bits (561), Expect = 3e-62 Identities = 109/148 (73%), Positives = 128/148 (86%) Frame = +1 Query: 22 TKILKAGAIEPDTFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPM 201 +K++KAG EPD FET I QA++ELE NSDLK QLR+LYIT+A+E+E +NKK+IIIYVP+ Sbjct: 5 SKVIKAGNGEPDAFETQIGQAILELEMNSDLKPQLRDLYITRAREVEFNNKKAIIIYVPV 64 Query: 202 PKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSVY 381 PK KAFQK+Q RLVRELEKKFSGKHVVF+ +R+ILPKP R NKQKRPRS +T+VY Sbjct: 65 PKQKAFQKVQTRLVRELEKKFSGKHVVFIAERRILPKPMRGRRDPNKQKRPRSPNVTAVY 124 Query: 382 DAILEDLVFPAEIVGKRIRVKLDASQLI 465 DAILEDLVFPAE+VGKRIRVKLD SQLI Sbjct: 125 DAILEDLVFPAEVVGKRIRVKLDGSQLI 152 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 23.0 bits (47), Expect = 5.3 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = +2 Query: 131 NCTLPRPRKLNFITKNQLSF--MCRCPN*RHSKRSKSGLSV 247 N TLP+ + N + QLSF PN R+ +S +S+ Sbjct: 239 NMTLPKRKPSNLEIRRQLSFQYFSTHPNGRNGILRRSSMSM 279 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 236 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 264 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. Length = 496 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 251 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 279 >AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 176 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 204 >AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 176 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 204 >AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 176 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 204 >AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 176 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 204 >AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 176 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 204 >AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 111 VRVSLKFNKSLRDRSLEGVGFYSTRFEDF 25 + +L+F+++L L G GF+ DF Sbjct: 176 IEKALRFSQNLEHFDLRGNGFHCGTLRDF 204 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 22.6 bits (46), Expect = 6.9 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -2 Query: 96 KFNKSLRDRSLEGVGFYSTRFEDFRTHLES 7 ++N D +L STRFED TH +S Sbjct: 238 RWNTRQFDPTLFESALRSTRFEDRATHAKS 267 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 22.2 bits (45), Expect = 9.2 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -3 Query: 329 RVLWLGLGRILRSPTNTTCLPLNF 258 R LWL L ++ R +TC F Sbjct: 211 RSLWLRLSKLARDTGFSTCYTFTF 234 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 493,750 Number of Sequences: 2352 Number of extensions: 10357 Number of successful extensions: 51 Number of sequences better than 10.0: 45 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 40395045 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -