BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_I15 (460 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9U505 Cluster: ATP synthase lipid-binding protein, mit... 136 3e-31 UniRef50_P48201 Cluster: ATP synthase lipid-binding protein, mit... 81 9e-15 UniRef50_P05496 Cluster: ATP synthase lipid-binding protein, mit... 81 9e-15 UniRef50_UPI0000E25CD7 Cluster: PREDICTED: hypothetical protein ... 63 3e-09 UniRef50_P48880 Cluster: ATP synthase protein 9, mitochondrial; ... 55 6e-07 UniRef50_Q01554 Cluster: ATP synthase protein 9, mitochondrial; ... 50 2e-05 UniRef50_P60112 Cluster: ATP synthase protein 9, mitochondrial; ... 46 4e-04 UniRef50_Q4Q9E5 Cluster: ATPase subunit 9, putative; n=15; Trypa... 45 7e-04 UniRef50_P00842 Cluster: ATP synthase protein 9, mitochondrial p... 44 0.002 UniRef50_A6RZ18 Cluster: Lipid-binding protein; n=2; Sclerotinia... 42 0.006 UniRef50_A3E3Y1 Cluster: Lipid-binding protein; n=1; Karlodinium... 40 0.034 UniRef50_UPI00015B585F Cluster: PREDICTED: similar to CG5912-PA;... 38 0.14 UniRef50_UPI0000D573BE Cluster: PREDICTED: similar to CG13320-PA... 38 0.14 UniRef50_Q7RI18 Cluster: ATPase subunit 9, putative; n=4; Plasmo... 38 0.14 UniRef50_Q4N435 Cluster: ATP synthase F0, subunit C, putative; n... 37 0.18 UniRef50_A7S1G4 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ... 37 0.24 UniRef50_Q37315 Cluster: ATP synthase protein 9, mitochondrial; ... 36 0.56 UniRef50_Q8IQ18 Cluster: CG33196-PB; n=10; Endopterygota|Rep: CG... 33 2.2 UniRef50_A2QU39 Cluster: Putative uncharacterized protein; n=1; ... 33 2.2 UniRef50_Q96E52 Cluster: Metalloendopeptidase OMA1, mitochondria... 33 2.2 UniRef50_Q5FRW6 Cluster: ATP synthase C chain; n=4; Rhodospirill... 33 3.9 UniRef50_UPI000155D216 Cluster: PREDICTED: similar to Chromosome... 32 5.2 UniRef50_UPI0000E7F9D1 Cluster: PREDICTED: similar to tripartite... 32 5.2 UniRef50_Q9FFP4 Cluster: Arabidopsis thaliana genomic DNA, chrom... 32 5.2 UniRef50_Q9NGP9 Cluster: Spore coat protein sp45; n=1; Polysphon... 32 5.2 UniRef50_A5K3T3 Cluster: Putative uncharacterized protein; n=1; ... 32 5.2 UniRef50_O43189 Cluster: PHD finger protein 1; n=37; Tetrapoda|R... 32 5.2 UniRef50_A1SHI6 Cluster: ATP synthase C chain; n=7; Actinomyceta... 32 6.8 UniRef50_Q94S31 Cluster: ATP synthase A chain; n=3; Daucus carot... 32 6.8 UniRef50_Q7RAX7 Cluster: Putative uncharacterized protein PY0637... 32 6.8 UniRef50_Q5ILI3 Cluster: ATP synthase F0 subunit c; n=1; Polysph... 32 6.8 UniRef50_Q6FSL0 Cluster: Similarities with sp|Q05854 Saccharomyc... 32 6.8 UniRef50_UPI00015B58BD Cluster: PREDICTED: hypothetical protein;... 31 9.0 UniRef50_UPI0000F2015F Cluster: PREDICTED: hypothetical protein;... 31 9.0 UniRef50_Q8W555 Cluster: AT3g07810/F17A17_15; n=11; Magnoliophyt... 31 9.0 UniRef50_Q9H8W5 Cluster: Tripartite motif-containing protein 45;... 31 9.0 >UniRef50_Q9U505 Cluster: ATP synthase lipid-binding protein, mitochondrial precursor; n=143; Eukaryota|Rep: ATP synthase lipid-binding protein, mitochondrial precursor - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) Length = 131 Score = 136 bits (328), Expect = 3e-31 Identities = 71/98 (72%), Positives = 74/98 (75%) Frame = +3 Query: 108 FSNTALVRPLAAVPTHTQIVPVAPAQLSAVRTFQTTSVTKDIDSAAKFXXXXXXXXXXXX 287 FSN A+VRPLAAV T TQ+VP APAQLSAVR+FQTTSVTKDIDSAAKF Sbjct: 17 FSNAAVVRPLAAVSTQTQLVPAAPAQLSAVRSFQTTSVTKDIDSAAKFIGAGAATVGVAG 76 Query: 288 XXXXXXXXFGSLIIGYARNPSLKQQLFSYAILGFALSE 401 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 77 SGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSE 114 >UniRef50_P48201 Cluster: ATP synthase lipid-binding protein, mitochondrial precursor; n=111; cellular organisms|Rep: ATP synthase lipid-binding protein, mitochondrial precursor - Homo sapiens (Human) Length = 142 Score = 81.4 bits (192), Expect = 9e-15 Identities = 41/68 (60%), Positives = 47/68 (69%) Frame = +3 Query: 198 RTFQTTSVTKDIDSAAKFXXXXXXXXXXXXXXXXXXXXFGSLIIGYARNPSLKQQLFSYA 377 R FQT+++++DID+AAKF FGSLIIGYARNPSLKQQLFSYA Sbjct: 58 REFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYA 117 Query: 378 ILGFALSE 401 ILGFALSE Sbjct: 118 ILGFALSE 125 >UniRef50_P05496 Cluster: ATP synthase lipid-binding protein, mitochondrial precursor; n=16; Eutheria|Rep: ATP synthase lipid-binding protein, mitochondrial precursor - Homo sapiens (Human) Length = 136 Score = 81.4 bits (192), Expect = 9e-15 Identities = 45/75 (60%), Positives = 50/75 (66%) Frame = +3 Query: 177 PAQLSAVRTFQTTSVTKDIDSAAKFXXXXXXXXXXXXXXXXXXXXFGSLIIGYARNPSLK 356 P Q+ A R FQT+ V++DID+AAKF FGSLIIGYARNPSLK Sbjct: 46 PLQV-ARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLK 104 Query: 357 QQLFSYAILGFALSE 401 QQLFSYAILGFALSE Sbjct: 105 QQLFSYAILGFALSE 119 >UniRef50_UPI0000E25CD7 Cluster: PREDICTED: hypothetical protein isoform 2; n=1; Pan troglodytes|Rep: PREDICTED: hypothetical protein isoform 2 - Pan troglodytes Length = 80 Score = 62.9 bits (146), Expect = 3e-09 Identities = 28/67 (41%), Positives = 41/67 (61%) Frame = -3 Query: 428 HHKTEETHSLRQGETQDGI*EQLLFKGGVPGITNDEGTEYRSNTRSGSSYSNCRCASTNE 249 HH+ + H L +G+ Q G+ E+LL + VPGITNDE ++ N +S+ NC S+NE Sbjct: 13 HHQAKAPHGLSEGKAQSGVGEELLLQRRVPGITNDEAPKHSPNLSRRASHPNCGSPSSNE 72 Query: 248 FGSRVNV 228 G V+V Sbjct: 73 LGCCVDV 79 >UniRef50_P48880 Cluster: ATP synthase protein 9, mitochondrial; n=4; Eukaryota|Rep: ATP synthase protein 9, mitochondrial - Chondrus crispus (Carragheen) Length = 76 Score = 55.2 bits (127), Expect = 6e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 312 FGSLIIGYARNPSLKQQLFSYAILGFALSE 401 FGSL++ YARNPSLKQQLF Y ILGFAL+E Sbjct: 31 FGSLVMAYARNPSLKQQLFGYTILGFALTE 60 >UniRef50_Q01554 Cluster: ATP synthase protein 9, mitochondrial; n=22; Eukaryota|Rep: ATP synthase protein 9, mitochondrial - Trichophyton rubrum Length = 74 Score = 50.0 bits (114), Expect = 2e-05 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +3 Query: 312 FGSLIIGYARNPSLKQQLFSYAILGFALSE 401 FG+LI+G ARNPSL+ LFSYAILGFA SE Sbjct: 28 FGALILGVARNPSLRGLLFSYAILGFAFSE 57 >UniRef50_P60112 Cluster: ATP synthase protein 9, mitochondrial; n=72; Eukaryota|Rep: ATP synthase protein 9, mitochondrial - Arabidopsis thaliana (Mouse-ear cress) Length = 85 Score = 46.0 bits (104), Expect = 4e-04 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = +3 Query: 312 FGSLIIGYARNPSLKQQLFSYAILGFALSE 401 F SLI ARNPSL +QLF YAILGFAL+E Sbjct: 39 FSSLIHSVARNPSLAKQLFGYAILGFALTE 68 >UniRef50_Q4Q9E5 Cluster: ATPase subunit 9, putative; n=15; Trypanosomatidae|Rep: ATPase subunit 9, putative - Leishmania major Length = 252 Score = 45.2 bits (102), Expect = 7e-04 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = +3 Query: 312 FGSLIIGYARNPSLKQQLFSYAILGFALSE 401 FG L+IG AR P+L + LF+YAILGFAL+E Sbjct: 207 FGCLLIGCARQPNLTKMLFNYAILGFALTE 236 >UniRef50_P00842 Cluster: ATP synthase protein 9, mitochondrial precursor; n=14; Pezizomycotina|Rep: ATP synthase protein 9, mitochondrial precursor - Neurospora crassa Length = 147 Score = 44.0 bits (99), Expect = 0.002 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = +3 Query: 312 FGSLIIGYARNPSLKQQLFSYAILGFALSE 401 F +L+ G ARNP+L+ QLFSYAILGFA E Sbjct: 102 FAALLNGVARNPALRGQLFSYAILGFAFVE 131 >UniRef50_A6RZ18 Cluster: Lipid-binding protein; n=2; Sclerotiniaceae|Rep: Lipid-binding protein - Botryotinia fuckeliana B05.10 Length = 149 Score = 41.9 bits (94), Expect = 0.006 Identities = 19/30 (63%), Positives = 23/30 (76%) Frame = +3 Query: 312 FGSLIIGYARNPSLKQQLFSYAILGFALSE 401 F +L+ ARNPS++ QLFSYAILGFA E Sbjct: 104 FAALLQAVARNPSMRGQLFSYAILGFAFVE 133 >UniRef50_A3E3Y1 Cluster: Lipid-binding protein; n=1; Karlodinium micrum|Rep: Lipid-binding protein - Karlodinium micrum (Dinoflagellate) Length = 130 Score = 39.5 bits (88), Expect = 0.034 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = +3 Query: 312 FGSLIIGYARNPSLKQQLFSYAILGFALSE 401 F +L++G ARNPS+K+ LF+Y ++G E Sbjct: 84 FAALVVGMARNPSMKEDLFTYTLIGMGFLE 113 >UniRef50_UPI00015B585F Cluster: PREDICTED: similar to CG5912-PA; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to CG5912-PA - Nasonia vitripennis Length = 1634 Score = 37.5 bits (83), Expect = 0.14 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Frame = -3 Query: 152 CRHCCEWSHKSC----VAEDSSPGCRGDQSCGIQHFCVLRGATTDNKE 21 C H C S SC V D CR SCG +HF L +TD+K+ Sbjct: 1238 CSHICLGSRCSCPQSLVLADDGKNCRVAPSCGPEHFTCLTSKSTDSKD 1285 >UniRef50_UPI0000D573BE Cluster: PREDICTED: similar to CG13320-PA, isoform A; n=1; Tribolium castaneum|Rep: PREDICTED: similar to CG13320-PA, isoform A - Tribolium castaneum Length = 378 Score = 37.5 bits (83), Expect = 0.14 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = +3 Query: 186 LSAVRTFQTTSVTKDIDSAAKF 251 L AVR+FQTT V++DIDSAAKF Sbjct: 32 LPAVRSFQTTPVSRDIDSAAKF 53 >UniRef50_Q7RI18 Cluster: ATPase subunit 9, putative; n=4; Plasmodium|Rep: ATPase subunit 9, putative - Plasmodium yoelii yoelii Length = 189 Score = 37.5 bits (83), Expect = 0.14 Identities = 13/30 (43%), Positives = 22/30 (73%) Frame = +3 Query: 312 FGSLIIGYARNPSLKQQLFSYAILGFALSE 401 F +L++G +RNPS+K +LF+Y ++G E Sbjct: 120 FSALVLGTSRNPSIKDELFTYTLIGMGFLE 149 >UniRef50_Q4N435 Cluster: ATP synthase F0, subunit C, putative; n=3; Piroplasmida|Rep: ATP synthase F0, subunit C, putative - Theileria parva Length = 163 Score = 37.1 bits (82), Expect = 0.18 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +3 Query: 312 FGSLIIGYARNPSLKQQLFSYAILGFALSE 401 F +L+ G ARNPS+K+ LF+Y ++G E Sbjct: 118 FAALVSGTARNPSIKEDLFTYTLIGMGFLE 147 >UniRef50_A7S1G4 Cluster: Predicted protein; n=3; Eumetazoa|Rep: Predicted protein - Nematostella vectensis Length = 276 Score = 36.7 bits (81), Expect = 0.24 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 176 CNWNNLCVCRHCCEWSHKSCVAEDSSPGCRGDQSCGIQHFC 54 C NN C HCC H C D GC GD C H C Sbjct: 46 CTRNNYCTRDHCCTRDH--CCIRDR--GCTGDHCCTRDHCC 82 >UniRef50_Q37315 Cluster: ATP synthase protein 9, mitochondrial; n=11; Eukaryota|Rep: ATP synthase protein 9, mitochondrial - Dictyostelium discoideum (Slime mold) Length = 88 Score = 35.5 bits (78), Expect = 0.56 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +3 Query: 312 FGSLIIGYARNPSLKQQLFSYAILGFALSE 401 F + I+ NP+L+ +LF A+LGFALSE Sbjct: 43 FAAFILAVGMNPNLRGELFKLAMLGFALSE 72 >UniRef50_Q8IQ18 Cluster: CG33196-PB; n=10; Endopterygota|Rep: CG33196-PB - Drosophila melanogaster (Fruit fly) Length = 23015 Score = 33.5 bits (73), Expect = 2.2 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -3 Query: 155 VCRHCCEWSH-KSCVAEDSSPGCRGDQSCGIQHFCV 51 +CRH E H + C+ + PGCR DQ C + CV Sbjct: 3115 LCRHDNECGHGELCLGLNCVPGCRSDQGCPPELSCV 3150 >UniRef50_A2QU39 Cluster: Putative uncharacterized protein; n=1; Aspergillus niger|Rep: Putative uncharacterized protein - Aspergillus niger Length = 197 Score = 33.5 bits (73), Expect = 2.2 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -3 Query: 320 GTEYRSNTRSGSSYSNCRCASTNEFGSRVNVFGDRG 213 GTEY ++T +GS+ +CR + S V +FG RG Sbjct: 2 GTEYTTSTTAGSTPVSCRSTVSGLINSVVRLFGPRG 37 >UniRef50_Q96E52 Cluster: Metalloendopeptidase OMA1, mitochondrial precursor; n=9; Theria|Rep: Metalloendopeptidase OMA1, mitochondrial precursor - Homo sapiens (Human) Length = 524 Score = 33.5 bits (73), Expect = 2.2 Identities = 13/36 (36%), Positives = 24/36 (66%) Frame = +3 Query: 108 FSNTALVRPLAAVPTHTQIVPVAPAQLSAVRTFQTT 215 FS L++ + AVP+ + + P++PA + A+R F T+ Sbjct: 104 FSRQLLIKEVTAVPSLSVLHPLSPASIRAIRNFHTS 139 >UniRef50_Q5FRW6 Cluster: ATP synthase C chain; n=4; Rhodospirillales|Rep: ATP synthase C chain - Gluconobacter oxydans (Gluconobacter suboxydans) Length = 85 Score = 32.7 bits (71), Expect = 3.9 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +3 Query: 312 FGSLIIGYARNPSLKQQLFSYAILGFALSE 401 F +LI ARNP+ + +F +LGFAL+E Sbjct: 40 FSTLISSVARNPASRPHVFGIGMLGFALTE 69 >UniRef50_UPI000155D216 Cluster: PREDICTED: similar to Chromosome 16 open reading frame 77; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to Chromosome 16 open reading frame 77 - Ornithorhynchus anatinus Length = 616 Score = 32.3 bits (70), Expect = 5.2 Identities = 19/50 (38%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = -3 Query: 341 PGITNDEGTEYRSNTRSGSSYSNCRCASTNEFGSRVNVFGD-RGGLEGAH 195 PG+T GS S RCA T+ G+R G+ GGLEG H Sbjct: 441 PGLTTPVVRGQPGELFGGSEASRARCAGTDGRGARQQKAGNLPGGLEGGH 490 >UniRef50_UPI0000E7F9D1 Cluster: PREDICTED: similar to tripartite motif-containing 45 isoform 1; n=4; Gallus gallus|Rep: PREDICTED: similar to tripartite motif-containing 45 isoform 1 - Gallus gallus Length = 531 Score = 32.3 bits (70), Expect = 5.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 38 SHPSKHKNAVCRKIDRPCSQDCYLQQH 118 SHPS+ C + D+P QDC ++H Sbjct: 143 SHPSEELGLFCEQCDQPVCQDCVAERH 169 >UniRef50_Q9FFP4 Cluster: Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MBK5; n=1; Arabidopsis thaliana|Rep: Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MBK5 - Arabidopsis thaliana (Mouse-ear cress) Length = 571 Score = 32.3 bits (70), Expect = 5.2 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -3 Query: 161 LCVCRHCCEWSHKSCVAEDSSPGCRGDQSCGIQHFCVL 48 LC + C + H+SCV +DSS GD + H C L Sbjct: 36 LCDFKDCPKVYHESCVEKDSSASKNGDSYICMWHSCYL 73 >UniRef50_Q9NGP9 Cluster: Spore coat protein sp45; n=1; Polysphondylium pallidum|Rep: Spore coat protein sp45 - Polysphondylium pallidum (Cellular slime mold) Length = 394 Score = 32.3 bits (70), Expect = 5.2 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 5/51 (9%) Frame = -3 Query: 170 WNNLCVCRHCCEWSH--KSCVAEDSSPGCR--GDQSCGIQHFC-VLRGATT 33 W + C HCC+ H +CV E S+ G D C I +FC L G T Sbjct: 227 WGHKCPFGHCCKNIHGVATCVPEHSTGGVSRCSDYHCPIGYFCQELNGIAT 277 >UniRef50_A5K3T3 Cluster: Putative uncharacterized protein; n=1; Plasmodium vivax|Rep: Putative uncharacterized protein - Plasmodium vivax Length = 1732 Score = 32.3 bits (70), Expect = 5.2 Identities = 35/118 (29%), Positives = 46/118 (38%), Gaps = 3/118 (2%) Frame = -3 Query: 419 TEETHSLRQGETQDGI*EQLLFKGGVPGITNDE-GTEYRSNTRSGSSYSNCRCASTNEFG 243 T+E SL G Q G E L KG T G R T SS +N RC+S N G Sbjct: 1300 TKEAASLG-GTDQGG--ENQLGKGSSTSCTRGHIGPHTRGGTTIRSSTTN-RCSSNNRCG 1355 Query: 242 SRVNVFGDRGGLEGAHS**LSRCNWNNLCVCRHCCE--WSHKSCVAEDSSPGCRGDQS 75 S +GG + AH + + +C+ W K AE G ++S Sbjct: 1356 SNNLGAPSKGGRKSAHRGGSHNMHRQDSSMCKQASPTGWGAKRTSAEQDEGGSEPNRS 1413 >UniRef50_O43189 Cluster: PHD finger protein 1; n=37; Tetrapoda|Rep: PHD finger protein 1 - Homo sapiens (Human) Length = 567 Score = 32.3 bits (70), Expect = 5.2 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -3 Query: 170 WN-NLCVCRHCCEWSHKSCVAEDSSPGCRGDQSCGIQHFCVLRG 42 WN + CR C +W H++C S P GD+ + CV RG Sbjct: 197 WNLKMLQCRSCLQWFHEACTQCLSKPLLYGDRFYEFE-CCVCRG 239 >UniRef50_A1SHI6 Cluster: ATP synthase C chain; n=7; Actinomycetales|Rep: ATP synthase C chain - Nocardioides sp. (strain BAA-499 / JS614) Length = 69 Score = 31.9 bits (69), Expect = 6.8 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +3 Query: 312 FGSLIIGYARNPSLKQQLFSYAILGFALSE 401 F + I G AR P + +L + AILGFAL+E Sbjct: 27 FAAYISGVARQPEAQSRLQAIAILGFALAE 56 >UniRef50_Q94S31 Cluster: ATP synthase A chain; n=3; Daucus carota|Rep: ATP synthase A chain - Daucus carota (Carrot) Length = 140 Score = 31.9 bits (69), Expect = 6.8 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +3 Query: 318 SLIIGYARNPSLKQQLFSYAILGFALS 398 SLI NPSL +QLF YAILG L+ Sbjct: 32 SLIESVTINPSLAKQLFGYAILGVPLA 58 >UniRef50_Q7RAX7 Cluster: Putative uncharacterized protein PY06372; n=4; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY06372 - Plasmodium yoelii yoelii Length = 648 Score = 31.9 bits (69), Expect = 6.8 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = -3 Query: 455 LESELQKERHHKTEETHSLRQGETQDGI*EQLLFKGGVPGITNDEGTEYRSNTRSGSSYS 276 LE +E +H EE + + G T GI + K + G T+D T+Y N +S S Sbjct: 337 LEENCHEENYH--EENNGINSGNTNSGIIDDKKNKKLINGKTDDIETKYDINMCEDTSSS 394 Query: 275 NC 270 C Sbjct: 395 LC 396 >UniRef50_Q5ILI3 Cluster: ATP synthase F0 subunit c; n=1; Polysphondylium pallidum|Rep: ATP synthase F0 subunit c - Polysphondylium pallidum (Cellular slime mold) Length = 87 Score = 31.9 bits (69), Expect = 6.8 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +3 Query: 312 FGSLIIGYARNPSLKQQLFSYAILGFALSE 401 F + ++ + NP+L+ +LF +LGFAL+E Sbjct: 42 FAAFVLSVSFNPNLRGELFKLTMLGFALTE 71 >UniRef50_Q6FSL0 Cluster: Similarities with sp|Q05854 Saccharomyces cerevisiae YLR278c; n=1; Candida glabrata|Rep: Similarities with sp|Q05854 Saccharomyces cerevisiae YLR278c - Candida glabrata (Yeast) (Torulopsis glabrata) Length = 1423 Score = 31.9 bits (69), Expect = 6.8 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -3 Query: 350 GGVPGITNDEGTEYRSNTRSGSS-YSNCRCASTNEFGSRVNVFGDRGGL 207 G + GIT GT+ R++T +GS+ SN ++N G +N+F G L Sbjct: 1350 GYMSGITFSSGTDARNDTSNGSNPTSNNNGNNSNIDGYNMNIFSSMGSL 1398 >UniRef50_UPI00015B58BD Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 430 Score = 31.5 bits (68), Expect = 9.0 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = -3 Query: 176 CNWNNLCVCRHCCEWSHKSCVAEDSSPGCRGDQSCG 69 C N C C CC+ K C S C +CG Sbjct: 231 CKCGNNCKCCGCCDGKKKGCCCSKSGGDCECCGACG 266 >UniRef50_UPI0000F2015F Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 1973 Score = 31.5 bits (68), Expect = 9.0 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +2 Query: 5 EVLLGVLCCQSSHPSKHKNAVCRKIDRPCSQDCYLQQH 118 EV G C Q P K VC RPC++ LQ+H Sbjct: 112 EVQEGTPCRQERKPQKPGKYVCTYCGRPCAKPSVLQKH 149 >UniRef50_Q8W555 Cluster: AT3g07810/F17A17_15; n=11; Magnoliophyta|Rep: AT3g07810/F17A17_15 - Arabidopsis thaliana (Mouse-ear cress) Length = 494 Score = 31.5 bits (68), Expect = 9.0 Identities = 22/66 (33%), Positives = 27/66 (40%), Gaps = 1/66 (1%) Frame = -3 Query: 356 FKGGVP-GITNDEGTEYRSNTRSGSSYSNCRCASTNEFGSRVNVFGDRGGLEGAHS**LS 180 F G+P G T GT Y N G S +TN FG V G GG + ++ Sbjct: 258 FDQGLPTGFTG--GTNYNGNVDYGRGMSPYYIGNTNRFGPAVGYEGGNGGGNSSFFSSVT 315 Query: 179 RCNWNN 162 R W N Sbjct: 316 RNLWGN 321 >UniRef50_Q9H8W5 Cluster: Tripartite motif-containing protein 45; n=28; Theria|Rep: Tripartite motif-containing protein 45 - Homo sapiens (Human) Length = 580 Score = 31.5 bits (68), Expect = 9.0 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +2 Query: 41 HPSKHKNAVCRKIDRPCSQDCYLQQHSS--CATTRSSAYTHTD 163 HP++ C DRP QDC + +H C T + + H D Sbjct: 194 HPAEELRLFCEFCDRPVCQDCVVGEHREHPCDFTSNVIHKHGD 236 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 420,695,183 Number of Sequences: 1657284 Number of extensions: 7677610 Number of successful extensions: 22665 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 21711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22645 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 24351434270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -