BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_I14 (547 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ524115-1|ABI35627.1| 123|Homo sapiens immunoglobulin heavy ch... 30 6.1 BC035035-1|AAH35035.1| 440|Homo sapiens ectonucleotide pyrophos... 30 6.1 AY358676-1|AAQ89039.1| 440|Homo sapiens AVKL1889 protein. 30 6.1 AK057370-1|BAB71455.1| 440|Homo sapiens protein ( Homo sapiens ... 30 6.1 >DQ524115-1|ABI35627.1| 123|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 123 Score = 29.9 bits (64), Expect = 6.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 384 DTTEVYFSAKDGIYVFDAKTNKTDKYGTNT 473 + T VY+ AKD I +F TN D +G T Sbjct: 88 EDTAVYYCAKDSITIFGVVTNAFDIWGQGT 117 >BC035035-1|AAH35035.1| 440|Homo sapiens ectonucleotide pyrophosphatase/phosphodiesterase 6 protein. Length = 440 Score = 29.9 bits (64), Expect = 6.1 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +3 Query: 417 GIYVFDAKTNKTDKYGTNTDSLIGIVKTNGSDVLYV 524 G Y++D TNK+ G N DSL+ + NGS+ L+V Sbjct: 91 GNYMWDPTTNKSFDIGVNKDSLMPL-WWNGSEPLWV 125 >AY358676-1|AAQ89039.1| 440|Homo sapiens AVKL1889 protein. Length = 440 Score = 29.9 bits (64), Expect = 6.1 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +3 Query: 417 GIYVFDAKTNKTDKYGTNTDSLIGIVKTNGSDVLYV 524 G Y++D TNK+ G N DSL+ + NGS+ L+V Sbjct: 91 GNYMWDPTTNKSFDIGVNKDSLMPL-WWNGSEPLWV 125 >AK057370-1|BAB71455.1| 440|Homo sapiens protein ( Homo sapiens cDNA FLJ32808 fis, clone TESTI2002707, weakly similar to PLASMA-CELL MEMBRANE GLYCOPROTEIN PC-1 [INCLUDES: ALKALINE ). Length = 440 Score = 29.9 bits (64), Expect = 6.1 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +3 Query: 417 GIYVFDAKTNKTDKYGTNTDSLIGIVKTNGSDVLYV 524 G Y++D TNK+ G N DSL+ + NGS+ L+V Sbjct: 91 GNYMWDPTTNKSFDIGVNKDSLMPL-WWNGSEPLWV 125 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,678,623 Number of Sequences: 237096 Number of extensions: 1153526 Number of successful extensions: 2867 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2867 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5364536570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -