BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_I10 (590 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0043 - 412675-412798,412891-412997,413104-413197,413733-41... 32 0.30 09_01_0066 - 978018-978500,978588-979034,979113-979412,979521-97... 28 4.8 11_03_0148 + 10762150-10762264,10762347-10762776,10764653-107647... 28 6.4 08_02_0853 - 21898293-21899564,21899910-21899964,21900079-21901034 28 6.4 09_01_0144 - 2158924-2158962,2159180-2159315,2159393-2159499,215... 27 8.5 04_01_0085 - 932461-932464,932656-933002,933387-935041,935084-93... 27 8.5 >06_01_0043 - 412675-412798,412891-412997,413104-413197,413733-413820, 413902-413943,414117-414223,414812-414942 Length = 230 Score = 32.3 bits (70), Expect = 0.30 Identities = 15/69 (21%), Positives = 34/69 (49%) Frame = +2 Query: 353 IEPKEETSNEEDNDLGNYEQKIFATEKRIKEERIDYNISWSPPDSADQESSLPCDSGQPW 532 +EP+ + ++ED+D + + + A +RIK+ER + N+ + ++ + + Sbjct: 115 VEPRSDDESDEDDDDDDDTEALMAELERIKKERAEENLRKERQQAEEEAKMKEAELMRGN 174 Query: 533 PFVKIEEQG 559 P + I G Sbjct: 175 PLININNAG 183 >09_01_0066 - 978018-978500,978588-979034,979113-979412,979521-979855, 980325-980703 Length = 647 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -1 Query: 185 PIPPARGDPTSFDGPTRGSALFISEVFRRYMSR 87 P PPAR PT P G+AL+ + RR + R Sbjct: 52 PTPPARRRPTKPASPPTGAALYRARRCRRKLLR 84 >11_03_0148 + 10762150-10762264,10762347-10762776,10764653-10764735, 10764980-10765068,10765178-10765251,10765333-10765383, 10765687-10765763,10766237-10767012 Length = 564 Score = 27.9 bits (59), Expect = 6.4 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +2 Query: 323 TDHIMNVIIKIEPKEETSNEEDNDLGNY 406 TD++M++ + EP S+ N +GNY Sbjct: 365 TDNVMDINVNTEPNNVVSSHFTNGVGNY 392 >08_02_0853 - 21898293-21899564,21899910-21899964,21900079-21901034 Length = 760 Score = 27.9 bits (59), Expect = 6.4 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +2 Query: 356 EPKEETSNEEDNDLGNYEQKIFATEKRIKEE-RIDYNISWSPPDSADQE 499 E ++E + E+N++ NYE++ E+R EE I+YN +S +E Sbjct: 529 ETEDEERDSEENEI-NYEEEADQDEEREAEENEINYNEEAEDEESETEE 576 >09_01_0144 - 2158924-2158962,2159180-2159315,2159393-2159499, 2159594-2160055,2162755-2162836,2164222-2164346, 2164555-2164623,2164935-2165056,2165823-2165856 Length = 391 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 470 WSPPDSADQESSLPCDSGQPW 532 W P ++Q+S LPC+ G PW Sbjct: 225 WMKPRPSEQKS-LPCEGGFPW 244 >04_01_0085 - 932461-932464,932656-933002,933387-935041,935084-935882, 936693-936707 Length = 939 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 437 IKEERIDYNISWSPPDSADQESSLPCDSGQPW 532 ++++ +DY W AD SS C S PW Sbjct: 256 LRQQHVDYTQHWDT--HADTTSSTCCHSSSPW 285 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,149,245 Number of Sequences: 37544 Number of extensions: 249534 Number of successful extensions: 708 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 708 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1400060088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -