BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_I04 (481 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_35674| Best HMM Match : SH2 (HMM E-Value=0) 48 3e-06 >SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1789 Score = 70.5 bits (165), Expect = 7e-13 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = +2 Query: 179 RKFMFNIADGGFTELHTLWLNEERAAAPGREYEIWHRRHDYWLLAG 316 +KFMFNIADGGFTELHTLW EE+ +IW R+HDYWLLAG Sbjct: 1746 KKFMFNIADGGFTELHTLWEGEEKRKCD----DIWGRKHDYWLLAG 1787 >SB_35674| Best HMM Match : SH2 (HMM E-Value=0) Length = 871 Score = 48.4 bits (110), Expect = 3e-06 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = +2 Query: 179 RKFMFNIADGGFTELHTLWLNEER 250 +KFMFNIADGGFTELHTLW EE+ Sbjct: 325 KKFMFNIADGGFTELHTLWEVEEK 348 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,275,499 Number of Sequences: 59808 Number of extensions: 133076 Number of successful extensions: 363 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 337 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 362 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1001731762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -