BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_I03 (423 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC044929-1|AAH44929.1| 364|Homo sapiens popeye domain containin... 29 6.5 BC026911-1|AAH26911.1| 178|Homo sapiens POPDC2 protein protein. 29 6.5 AF204173-1|AAG23406.1| 366|Homo sapiens popeye protein 2 protein. 29 6.5 >BC044929-1|AAH44929.1| 364|Homo sapiens popeye domain containing 2 protein. Length = 364 Score = 29.1 bits (62), Expect = 6.5 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 3/36 (8%) Frame = -1 Query: 234 STCSYIVS*RKSLHCILV---YVATLYLSVCSYTVS 136 ++CSYI RKSLH +L Y++ L+ ++ Y +S Sbjct: 207 TSCSYISWPRKSLHLLLTKERYISCLFSALLGYDIS 242 >BC026911-1|AAH26911.1| 178|Homo sapiens POPDC2 protein protein. Length = 178 Score = 29.1 bits (62), Expect = 6.5 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 3/36 (8%) Frame = -1 Query: 234 STCSYIVS*RKSLHCILV---YVATLYLSVCSYTVS 136 ++CSYI RKSLH +L Y++ L+ ++ Y +S Sbjct: 25 TSCSYISWPRKSLHLLLTKERYISCLFSALLGYDIS 60 >AF204173-1|AAG23406.1| 366|Homo sapiens popeye protein 2 protein. Length = 366 Score = 29.1 bits (62), Expect = 6.5 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 3/36 (8%) Frame = -1 Query: 234 STCSYIVS*RKSLHCILV---YVATLYLSVCSYTVS 136 ++CSYI RKSLH +L Y++ L+ ++ Y +S Sbjct: 207 TSCSYISWPRKSLHLLLTKERYISCLFSALLGYDIS 242 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 47,929,955 Number of Sequences: 237096 Number of extensions: 770927 Number of successful extensions: 656 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 656 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3259265358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -