BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_I02 (601 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 25 0.75 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 23 1.7 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 23 1.7 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 23 1.7 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 7.0 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 9.2 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 24.6 bits (51), Expect = 0.75 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +3 Query: 423 SLHHWKGNRRLGPRPHPQTR*PMHRPPGIPHL 518 S HH GN +GP P H+ + HL Sbjct: 333 SPHHQHGNHTMGPTMGPPHHHHHHQTQSLQHL 364 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 585 VNGESLHEERSETRTGATTERVEDE 511 V+ E+ H ERS R+ A ++DE Sbjct: 254 VSSETNHNERSTPRSHAKPSLIDDE 278 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 585 VNGESLHEERSETRTGATTERVEDE 511 V+ E+ H ERS R+ A ++DE Sbjct: 254 VSSETNHNERSTPRSHAKPSLIDDE 278 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 585 VNGESLHEERSETRTGATTERVEDE 511 V+ E+ H ERS R+ A ++DE Sbjct: 254 VSSETNHNERSTPRSHAKPSLIDDE 278 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.4 bits (43), Expect = 7.0 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +1 Query: 268 ETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQL 363 E A H+ + D+EPTV RQL Sbjct: 236 ERRAQSHLEAHCYFDIEPTVQQHQPVTVNRQL 267 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -1 Query: 169 PSRHFRSGLR 140 P RH+RSGL+ Sbjct: 139 PLRHYRSGLK 148 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,018 Number of Sequences: 438 Number of extensions: 4662 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -