BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_H24 (560 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L14837-1|AAA02891.1| 1736|Homo sapiens tight junction (zonula oc... 30 4.8 DQ015919-1|AAY22179.1| 1748|Homo sapiens tight junction protein ... 30 4.8 BC111712-1|AAI11713.1| 1748|Homo sapiens tight junction protein ... 30 4.8 >L14837-1|AAA02891.1| 1736|Homo sapiens tight junction (zonula occludens) protein ZO-1 protein. Length = 1736 Score = 30.3 bits (65), Expect = 4.8 Identities = 12/49 (24%), Positives = 25/49 (51%) Frame = +3 Query: 27 SDPPKYGSYTYQYSCRSEPYPVSLQHVQLVPCMCPVAPEEAEKLQEQSG 173 + PP++ S +S +E + ++ VP PV+P E+ +++ G Sbjct: 1569 AQPPEFDSGVETFSIHAEKPKYQINNISTVPKAIPVSPSAVEEDEDEDG 1617 >DQ015919-1|AAY22179.1| 1748|Homo sapiens tight junction protein 1 (zona occludens 1) protein. Length = 1748 Score = 30.3 bits (65), Expect = 4.8 Identities = 12/49 (24%), Positives = 25/49 (51%) Frame = +3 Query: 27 SDPPKYGSYTYQYSCRSEPYPVSLQHVQLVPCMCPVAPEEAEKLQEQSG 173 + PP++ S +S +E + ++ VP PV+P E+ +++ G Sbjct: 1581 AQPPEFDSGVETFSIHAEKPKYQINNISTVPKAIPVSPSAVEEDEDEDG 1629 >BC111712-1|AAI11713.1| 1748|Homo sapiens tight junction protein 1 (zona occludens 1) protein. Length = 1748 Score = 30.3 bits (65), Expect = 4.8 Identities = 12/49 (24%), Positives = 25/49 (51%) Frame = +3 Query: 27 SDPPKYGSYTYQYSCRSEPYPVSLQHVQLVPCMCPVAPEEAEKLQEQSG 173 + PP++ S +S +E + ++ VP PV+P E+ +++ G Sbjct: 1581 AQPPEFDSGVETFSIHAEKPKYQINNISTVPKAIPVSPSAVEEDEDEDG 1629 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,789,391 Number of Sequences: 237096 Number of extensions: 1444443 Number of successful extensions: 3118 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3052 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3118 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5646880600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -