BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_H23 (475 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 23 1.9 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 23 1.9 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 23 1.9 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 7.7 AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 21 7.7 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 22.6 bits (46), Expect = 1.9 Identities = 10/23 (43%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +1 Query: 394 WFNE-YKDYKYAPLKQSDFDKSK 459 W N Y++YK P SD DK++ Sbjct: 11 WTNSFYQNYKTNPFLASDCDKNQ 33 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 22.6 bits (46), Expect = 1.9 Identities = 10/23 (43%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +1 Query: 394 WFNE-YKDYKYAPLKQSDFDKSK 459 W N Y++YK P SD DK++ Sbjct: 11 WTNSFYQNYKTNPFLASDCDKNQ 33 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 22.6 bits (46), Expect = 1.9 Identities = 10/23 (43%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +1 Query: 394 WFNE-YKDYKYAPLKQSDFDKSK 459 W N Y++YK P SD DK++ Sbjct: 11 WTNSFYQNYKTNPFLASDCDKNQ 33 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 20.6 bits (41), Expect = 7.7 Identities = 8/34 (23%), Positives = 14/34 (41%) Frame = +1 Query: 337 WYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQ 438 W+S + + + +A Y +Y PL Q Sbjct: 267 WFSNRRARLRKQITSAATPLVRSYAPERYPPLAQ 300 >AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord defective protein protein. Length = 168 Score = 20.6 bits (41), Expect = 7.7 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = +1 Query: 88 HSKSLLNLSCKQIKDFVNGHNYR 156 H S++ L+ Q+K + H Y+ Sbjct: 72 HLASIIRLTPTQVKIWFQNHRYK 94 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,150 Number of Sequences: 336 Number of extensions: 2397 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11036865 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -