BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_H23 (475 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 45 2e-06 Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protei... 40 4e-05 AF457548-1|AAL68778.1| 178|Anopheles gambiae antigen 5-related ... 36 5e-04 AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection... 23 5.4 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 22 9.5 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 44.8 bits (101), Expect = 2e-06 Identities = 32/112 (28%), Positives = 45/112 (40%), Gaps = 2/112 (1%) Frame = +1 Query: 145 HNYRRQLLAKGQVSGHPAATEMKYMVWDEELXXXXXXXXXQNKNFHNPDKTLGSGRFQTG 324 HN RR LA GQ+ A M + WDEEL + H+ + + G Sbjct: 71 HNTRRSQLALGQLKPFLPAVRMPTLTWDEELAKQAGNNARSCQYQHDSCRNTPVYAW-AG 129 Query: 325 EN--LYWYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGH 474 +N L +S +T + + SW+NEY K L S P +GH Sbjct: 130 QNIALAQFSRMTNTISQLISTNIASWWNEYSFTKQEQLNFYPSSNSGPAMGH 181 >Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protein precursor protein. Length = 260 Score = 39.9 bits (89), Expect = 4e-05 Identities = 28/113 (24%), Positives = 49/113 (43%), Gaps = 3/113 (2%) Frame = +1 Query: 145 HNYRRQLLAKGQVSGHPAATEMKYMVWDEELXXXXXXXXXQNKNFHNPDKTLGSGRF-QT 321 HN R +A G++ +P+A +M + WD EL H D+ + +F Sbjct: 73 HNLNRSNIALGRIRPYPSAVKMPTLTWDPELASLADANARSCNYGH--DRCRATKKFPYA 130 Query: 322 GEN--LYWYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGH 474 G+N + + T K + + SW++EY D + +++ S IGH Sbjct: 131 GQNIAITQFFGYRFTEKDLIHKFVSSWWSEYLDARPEHVRKYPSSYSGKPIGH 183 >AF457548-1|AAL68778.1| 178|Anopheles gambiae antigen 5-related 1 protein protein. Length = 178 Score = 36.3 bits (80), Expect = 5e-04 Identities = 24/93 (25%), Positives = 41/93 (44%), Gaps = 3/93 (3%) Frame = +1 Query: 145 HNYRRQLLAKGQVSGHPAATEMKYMVWDEELXXXXXXXXXQNKNFHNPDKTLGSGRF-QT 321 HN R +A G++ +P+A +M + WD EL H D+ + +F Sbjct: 73 HNLNRSNIALGRIRPYPSAVKMPTLTWDPELASLADANARSCNYGH--DRCRATKKFPYA 130 Query: 322 GEN--LYWYSTTDSTYKLNVDNAMESWFNEYKD 414 G+N + + T K + + SW++EY D Sbjct: 131 GQNIAITQFFGYRFTEKDLIHKFVSSWWSEYLD 163 >AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection responsive shortpeptide protein. Length = 81 Score = 23.0 bits (47), Expect = 5.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -2 Query: 87 DVSNTYDHCQNKKRAYGHCS 28 D T + C++ KR +G CS Sbjct: 53 DGQTTINSCEDCKRKFGRCS 72 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 22.2 bits (45), Expect = 9.5 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = -1 Query: 442 HSVSREHICNLYIH*TNSP--*RCP 374 H REH+C + + T+SP RCP Sbjct: 998 HGFFREHLCGMQL--TSSPDCTRCP 1020 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 498,623 Number of Sequences: 2352 Number of extensions: 9699 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 41670678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -