BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_H21 (515 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370043-1|ABD18604.1| 161|Anopheles gambiae putative TIL domai... 25 2.0 DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domai... 25 2.0 AJ271353-1|CAB69785.1| 380|Anopheles gambiae putative serine pr... 25 2.0 AJ271352-1|CAB69784.1| 379|Anopheles gambiae putative serine pr... 25 2.0 AY341219-1|AAR13783.1| 200|Anopheles gambiae SRPN10 protein. 24 2.6 AY341218-1|AAR13782.1| 200|Anopheles gambiae SRPN10 protein. 24 2.6 AY341217-1|AAR13781.1| 200|Anopheles gambiae SRPN10 protein. 24 2.6 AY341216-1|AAR13780.1| 200|Anopheles gambiae SRPN10 protein. 24 2.6 AY341215-1|AAR13779.1| 200|Anopheles gambiae SRPN10 protein. 24 2.6 AJ420785-4|CAD12784.1| 395|Anopheles gambiae serpin protein. 24 2.6 AJ420785-3|CAD12783.1| 380|Anopheles gambiae serpin protein. 24 2.6 AJ420785-2|CAD12782.1| 382|Anopheles gambiae serpin protein. 24 2.6 AJ420785-1|CAD12781.1| 379|Anopheles gambiae serpin protein. 24 2.6 DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domai... 23 4.6 EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. 23 6.1 AF513639-1|AAM53611.1| 195|Anopheles gambiae glutathione S-tran... 23 6.1 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 8.1 AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-tran... 23 8.1 >DQ370043-1|ABD18604.1| 161|Anopheles gambiae putative TIL domain polypeptide protein. Length = 161 Score = 24.6 bits (51), Expect = 2.0 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -3 Query: 513 CPYQHPYVFSLSCRYSNEYISRC 445 CPY HPY + L C NE + C Sbjct: 24 CPYAHPYPYDL-CG-PNEELLEC 44 >DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domain polypeptide protein. Length = 194 Score = 24.6 bits (51), Expect = 2.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 513 CPYQHPYVFSLSCRYSNEY 457 CPY HPY + L C + E+ Sbjct: 24 CPYAHPYPYDL-CGPNEEF 41 >AJ271353-1|CAB69785.1| 380|Anopheles gambiae putative serine protease inhibitor protein. Length = 380 Score = 24.6 bits (51), Expect = 2.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 112 DNVTAITKITGWVNVTTNNE 171 ++ A KI GWV TNN+ Sbjct: 131 ESAAAAKKINGWVEENTNNK 150 >AJ271352-1|CAB69784.1| 379|Anopheles gambiae putative serine protease inhibitor protein. Length = 379 Score = 24.6 bits (51), Expect = 2.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 112 DNVTAITKITGWVNVTTNNE 171 ++ A KI GWV TNN+ Sbjct: 131 ESAAAAKKINGWVEENTNNK 150 >AY341219-1|AAR13783.1| 200|Anopheles gambiae SRPN10 protein. Length = 200 Score = 24.2 bits (50), Expect = 2.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 112 DNVTAITKITGWVNVTTNNE 171 ++ A KI GWV TNN+ Sbjct: 176 ESAAAAKKINGWVEEKTNNK 195 >AY341218-1|AAR13782.1| 200|Anopheles gambiae SRPN10 protein. Length = 200 Score = 24.2 bits (50), Expect = 2.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 112 DNVTAITKITGWVNVTTNNE 171 ++ A KI GWV TNN+ Sbjct: 176 ESAAAAKKINGWVEEKTNNK 195 >AY341217-1|AAR13781.1| 200|Anopheles gambiae SRPN10 protein. Length = 200 Score = 24.2 bits (50), Expect = 2.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 112 DNVTAITKITGWVNVTTNNE 171 ++ A KI GWV TNN+ Sbjct: 176 ESAAAAKKINGWVEEKTNNK 195 >AY341216-1|AAR13780.1| 200|Anopheles gambiae SRPN10 protein. Length = 200 Score = 24.2 bits (50), Expect = 2.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 112 DNVTAITKITGWVNVTTNNE 171 ++ A KI GWV TNN+ Sbjct: 176 ESAAAAKKINGWVEEKTNNK 195 >AY341215-1|AAR13779.1| 200|Anopheles gambiae SRPN10 protein. Length = 200 Score = 24.2 bits (50), Expect = 2.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 112 DNVTAITKITGWVNVTTNNE 171 ++ A KI GWV TNN+ Sbjct: 176 ESAAAAKKINGWVEEKTNNK 195 >AJ420785-4|CAD12784.1| 395|Anopheles gambiae serpin protein. Length = 395 Score = 24.2 bits (50), Expect = 2.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 112 DNVTAITKITGWVNVTTNNE 171 ++ A KI GWV TNN+ Sbjct: 131 ESAAAAKKINGWVEEKTNNK 150 >AJ420785-3|CAD12783.1| 380|Anopheles gambiae serpin protein. Length = 380 Score = 24.2 bits (50), Expect = 2.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 112 DNVTAITKITGWVNVTTNNE 171 ++ A KI GWV TNN+ Sbjct: 131 ESAAAAKKINGWVEEKTNNK 150 >AJ420785-2|CAD12782.1| 382|Anopheles gambiae serpin protein. Length = 382 Score = 24.2 bits (50), Expect = 2.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 112 DNVTAITKITGWVNVTTNNE 171 ++ A KI GWV TNN+ Sbjct: 131 ESAAAAKKINGWVEEKTNNK 150 >AJ420785-1|CAD12781.1| 379|Anopheles gambiae serpin protein. Length = 379 Score = 24.2 bits (50), Expect = 2.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 112 DNVTAITKITGWVNVTTNNE 171 ++ A KI GWV TNN+ Sbjct: 131 ESAAAAKKINGWVEEKTNNK 150 >DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domain polypeptide protein. Length = 168 Score = 23.4 bits (48), Expect = 4.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 513 CPYQHPYVFSLSCRYSNEY 457 CPY HPY + + C + E+ Sbjct: 24 CPYAHPYPYDV-CGPNEEF 41 >EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. Length = 481 Score = 23.0 bits (47), Expect = 6.1 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = +2 Query: 173 TRSSWPCSNTARYQSQSMRPTRPSVSTRTVYISNRNAKTKW 295 T + W + + + PT STR + S N K KW Sbjct: 224 TANDWVARKSQGLIREIVAPTALDASTRLLMASVINFKGKW 264 >AF513639-1|AAM53611.1| 195|Anopheles gambiae glutathione S-transferase S1-2 protein. Length = 195 Score = 23.0 bits (47), Expect = 6.1 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 109 IDNVTAITKITGWVNVTTNNE 171 +DNVT+I I W++ E Sbjct: 174 VDNVTSIESIRSWIDKRPKTE 194 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +2 Query: 209 YQSQSMRPTRPSVSTRTVYISNRNAKTKWMS*TTPS 316 YQ + RPS + + V +S+ + W +P+ Sbjct: 59 YQQTEPKSHRPSYANKAVLLSSAKWEQMWKKVVSPA 94 >AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-transferase u2 protein. Length = 222 Score = 22.6 bits (46), Expect = 8.1 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 46 KHGLPTEEDYGGYLGQ 93 +H +PT +D G YLG+ Sbjct: 52 EHTIPTLDDNGFYLGE 67 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 569,141 Number of Sequences: 2352 Number of extensions: 10370 Number of successful extensions: 44 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -