BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_H20 (469 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z67882-3|CAA91800.2| 1324|Caenorhabditis elegans Hypothetical pr... 27 5.1 AF068717-4|AAC17764.2| 357|Caenorhabditis elegans Serpentine re... 27 8.9 >Z67882-3|CAA91800.2| 1324|Caenorhabditis elegans Hypothetical protein F22E10.2 protein. Length = 1324 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 346 KWLHSACHYCRSDRFNPMVTCFCF 275 K ++ A +YC S F ++CFCF Sbjct: 984 KSVYEAVNYCISQNFMYYMSCFCF 1007 >AF068717-4|AAC17764.2| 357|Caenorhabditis elegans Serpentine receptor, class w protein144 protein. Length = 357 Score = 26.6 bits (56), Expect = 8.9 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +1 Query: 109 NSVSSHTKQ*RVLSCVFYASAFPCGYGLRLLNFLYQFYEFRINL 240 N S +T+ L+CVF+ + FP G + + F + F I L Sbjct: 264 NDSSKNTQLVLFLTCVFFIAQFPIGISIGVSYFFSETPGFTIML 307 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,258,970 Number of Sequences: 27780 Number of extensions: 193379 Number of successful extensions: 411 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 407 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 411 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 839684522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -