BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_H19 (398 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0028 - 359988-359996,360228-360332,360415-360536,360676-36... 47 6e-06 05_03_0031 - 7534327-7534480,7535546-7535649,7535724-7535793,753... 44 6e-05 03_02_0234 + 6625417-6626184,6626314-6626339,6626435-6626531,662... 42 2e-04 03_01_0227 - 1797353-1798519 41 4e-04 06_01_0584 - 4178391-4178732,4178854-4178915,4180361-4180481,418... 38 0.004 10_05_0046 + 8516043-8516425,8517908-8518019,8518276-8518377,851... 33 0.063 10_08_0653 + 19606476-19606752,19607210-19608436,19614698-19614942 31 0.34 05_01_0291 - 2274587-2274676,2274871-2275076,2275638-2275719,227... 30 0.59 08_01_0903 - 8897977-8899016,8899128-8899300,8901553-8901666,890... 30 0.77 01_06_1556 - 38222071-38222708,38222795-38222822,38222950-382230... 30 0.77 11_04_0272 - 15631598-15631898,15633162-15633291,15636394-156365... 29 1.0 10_02_0198 - 6611775-6612611 29 1.4 07_03_1567 - 27772815-27773302,27773471-27773561,27773641-277739... 29 1.8 02_05_0491 + 29470575-29471351,29471574-29471806,29472697-294728... 29 1.8 06_03_0557 + 22133604-22134506 28 2.4 08_02_0235 + 14627648-14628889 28 3.1 07_01_1086 - 9930311-9931993 28 3.1 12_02_0637 - 21437244-21438080 27 4.1 12_02_0141 + 14303418-14303687,14304447-14304586,14304744-14305569 27 4.1 10_01_0300 - 3257584-3258825 27 4.1 03_05_0176 + 21546952-21547887,21548856-21548921,21549959-215508... 27 4.1 11_01_0792 + 6679002-6679603,6738490-6738520,6738532-6739644 27 5.5 10_05_0084 + 8956637-8956681,8957722-8957856,8958040-8958834 27 5.5 04_01_0293 + 3881375-3883698,3906619-3907636,3907820-3908309,391... 27 5.5 11_03_0201 + 11578163-11578915 27 7.2 07_03_1512 + 27288779-27289222,27298101-27298399,27298499-272985... 27 7.2 06_02_0319 + 14306464-14306577,14306623-14307117 27 7.2 03_02_1029 - 13488535-13493037 27 7.2 10_07_0032 + 12096290-12097042,12097056-12098066,12110194-12110454 26 9.5 09_02_0555 - 10588685-10592038 26 9.5 06_03_1048 + 27146475-27146652,27146739-27146804,27146880-271469... 26 9.5 >10_01_0028 - 359988-359996,360228-360332,360415-360536,360676-360763, 360988-361056,361132-361461,361544-361610,361695-361753, 361838-362056,362224-362289,362370-362500,362683-362782, 362864-363001,363111-363218,363627-363723,363806-364257 Length = 719 Score = 46.8 bits (106), Expect = 6e-06 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 5/69 (7%) Frame = +2 Query: 80 GKKDKKTETSDGSSEEEFVVEKVLD----KRTVKGKIQYLLKWKGYKEDESTWEPVENL- 244 G + + + + ++EFVVEK+ + + + ++WKGY +E TWEP+ENL Sbjct: 398 GASENEEDDDEPLEKDEFVVEKLAGICYGGSGREDGLYFKVQWKGYGREEDTWEPIENLR 457 Query: 245 DCEELIKAF 271 DC IK F Sbjct: 458 DCPLKIKEF 466 >05_03_0031 - 7534327-7534480,7535546-7535649,7535724-7535793, 7535889-7535932,7536042-7536146,7536223-7536344, 7536807-7536894,7536966-7537052,7537718-7537786, 7537859-7538188,7539777-7539824,7540003-7540069, 7540150-7540208,7541220-7541453,7541536-7541601, 7541684-7541883,7542104-7542197,7542295-7542414, 7542596-7542703,7542808-7542871,7543378-7543409, 7546049-7548007 Length = 1407 Score = 43.6 bits (98), Expect = 6e-05 Identities = 26/70 (37%), Positives = 38/70 (54%), Gaps = 9/70 (12%) Frame = +2 Query: 89 DKKTETSDGSS--EEEFVVEKVLD------KRTVKGKIQYLLKWKGYKEDESTWEPVENL 244 + ET D S+ EEF V K++D + K + + ++WKGY TWEPVE L Sbjct: 919 ESNNETPDCSTVPPEEFEVWKLVDICFGDPNKVSKHGLYFKVRWKGYGPHHDTWEPVEGL 978 Query: 245 -DCEELIKAF 271 +C+E I+ F Sbjct: 979 RNCKEAIRDF 988 >03_02_0234 + 6625417-6626184,6626314-6626339,6626435-6626531, 6627009-6627116,6627194-6627328,6627429-6627528, 6627763-6627974,6628060-6628125,6628231-6628464, 6628583-6628641,6628716-6628782,6628863-6629192, 6629267-6629335,6629417-6629503,6629605-6629692, 6630057-6630178,6630251-6630355,6630442-6630485, 6630558-6630627,6630711-6630814,6630980-6631189, 6632935-6633018,6633291-6634003,6634115-6634649, 6634703-6634789,6634826-6634970,6635049-6635125, 6635215-6635359,6635462-6635626,6635725-6635958 Length = 1761 Score = 41.9 bits (94), Expect = 2e-04 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 7/57 (12%) Frame = +2 Query: 122 EEEFVVEKVLD------KRTVKGKIQYLLKWKGYKEDESTWEPVENL-DCEELIKAF 271 E+ F VE++L+ T K + + ++WKGY TWEP++ L DC E IK F Sbjct: 555 EDIFDVEELLEICYGDPSNTGKNGLWFKVRWKGYDPSYDTWEPIDGLSDCPERIKEF 611 >03_01_0227 - 1797353-1798519 Length = 388 Score = 40.7 bits (91), Expect = 4e-04 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 3/48 (6%) Frame = +2 Query: 125 EEFVVEKVLDKRTV---KGKIQYLLKWKGYKEDESTWEPVENLDCEEL 259 E V E V++KR +GK +YL+KW +E+TWEP EN+D E L Sbjct: 319 EYAVAEAVVNKREAAEGEGKWEYLVKWVDI--EEATWEPAENVDAELL 364 >06_01_0584 - 4178391-4178732,4178854-4178915,4180361-4180481, 4180592-4180732,4180830-4180959,4182306-4182436, 4182528-4182601,4182680-4182741,4183135-4183209, 4184658-4184760,4184835-4184991,4185549-4185743, 4186204-4186282,4186697-4186806,4187249-4187374, 4187475-4187541,4187622-4187791,4187880-4188018, 4188361-4188522,4188672-4188772,4188852-4188994, 4189438-4189537,4190364-4190414,4191062-4191169, 4191279-4191494,4191585-4191721,4191820-4191915, 4192017-4192234,4192764-4192925,4193006-4193163, 4194221-4194379 Length = 1364 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +2 Query: 62 NYYLEMGKKDKKTETSDGSSEEEFVVEKVL-DKRTVKGKIQYLLKWKGYKEDESTWE 229 N++ +M DK + E V+++L +++ G+ +Y +KWK DE TWE Sbjct: 128 NFHKQMDSTDKSDDDYSAIRPEWTTVDRILATRKSSTGEREYYVKWKELTYDECTWE 184 Score = 31.1 bits (67), Expect = 0.34 Identities = 20/51 (39%), Positives = 24/51 (47%) Frame = +2 Query: 74 EMGKKDKKTETSDGSSEEEFVVEKVLDKRTVKGKIQYLLKWKGYKEDESTW 226 EM K ET +SEE E K+ VK +YL+KWKG TW Sbjct: 59 EMEKILDCEETKPDASEETSSSESGSKKKPVK---RYLIKWKGISHLHCTW 106 >10_05_0046 + 8516043-8516425,8517908-8518019,8518276-8518377, 8518605-8518657,8518976-8519062,8519162-8519830, 8520154-8520214,8520295-8520342 Length = 504 Score = 33.5 bits (73), Expect = 0.063 Identities = 13/26 (50%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +2 Query: 197 KGYKEDESTWEPVENLD-CEELIKAF 271 +G+ E +TWEP+ENL C ++I AF Sbjct: 218 RGWPESANTWEPLENLSACSDIIDAF 243 Score = 31.1 bits (67), Expect = 0.34 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +2 Query: 119 SEEEFVVEKVLDKRTVKGKIQYLLKWKGYKEDESTWE 229 +E + +E + +R KGK+QYL+KW G + + W+ Sbjct: 103 AEGYYEIEDIRRRRLRKGKLQYLVKW-GSQWEGGAWD 138 >10_08_0653 + 19606476-19606752,19607210-19608436,19614698-19614942 Length = 582 Score = 31.1 bits (67), Expect = 0.34 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 128 EFVVEKVLDKRTVKGKIQYLLKWKGYKEDESTWE 229 E ++E+ L KR +Q LLKW D +TWE Sbjct: 512 EAILERRLVKRGNAAHVQVLLKWSLLPADHATWE 545 >05_01_0291 - 2274587-2274676,2274871-2275076,2275638-2275719, 2275948-2276064,2276489-2276751,2277548-2277620, 2278324-2278427,2278613-2278706 Length = 342 Score = 30.3 bits (65), Expect = 0.59 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 143 KVLDKR-TVKGKIQYLLKWKGYKEDESTWEPV 235 K+ D R T G QYLL++ Y ++E TW V Sbjct: 66 KINDMRVTETGSFQYLLEYLDYPDEEKTWTEV 97 >08_01_0903 - 8897977-8899016,8899128-8899300,8901553-8901666, 8901743-8901836,8901925-8902103,8902165-8902496, 8913058-8913306 Length = 726 Score = 29.9 bits (64), Expect = 0.77 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = -1 Query: 224 KCSHLLYNLSISINIVSFPSQYVYRELFQQQTLLHLIHRWFQFFYLF 84 +C+ L ++ +++ ++P Y Y F+Q LL I R Y + Sbjct: 381 RCTPLAIRIAAGLSLSAYPPPYSYTSAFKQYPLLQGIKRMLHISYAY 427 >01_06_1556 - 38222071-38222708,38222795-38222822,38222950-38223070, 38223206-38223318,38223424-38223506,38223868-38223930, 38224100-38224254,38224411-38224580,38225101-38225189, 38225304-38225496,38225655-38225779,38226069-38226475, 38226855-38226919,38227414-38227692,38227772-38227845, 38228241-38228292,38228366-38228473,38228871-38228972, 38229100-38229173,38229262-38229435,38229667-38229771, 38229867-38229977,38230364-38230487 Length = 1150 Score = 29.9 bits (64), Expect = 0.77 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 179 QYLLKWKGYKEDESTWEP 232 ++L+KWKG E+TWEP Sbjct: 473 EFLVKWKGLDYCEATWEP 490 >11_04_0272 - 15631598-15631898,15633162-15633291,15636394-15636544, 15636632-15636730,15636912-15637063,15637079-15637301 Length = 351 Score = 29.5 bits (63), Expect = 1.0 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 1/81 (1%) Frame = +2 Query: 5 EGHFKVLVLQRRCFTVYHINYYLEMGKKDKKTETSDGSSEEEFVVEKVLDKRTVKGKIQY 184 E H ++L+L + H ++G + ++EE V V D +T I++ Sbjct: 167 ESHPQILILHEEYDRIIH-----KVGIALGVYNLTKNTAEESNTV--VTDLKTRNQTIRF 219 Query: 185 L-LKWKGYKEDESTWEPVENL 244 L ++W Y DE+TWE ++L Sbjct: 220 LKVQWSHYTMDEATWEKEDDL 240 >10_02_0198 - 6611775-6612611 Length = 278 Score = 29.1 bits (62), Expect = 1.4 Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +2 Query: 149 LDKRTVKGKIQYLLK--WKGYKEDESTWEPVENL 244 +D+R + ++ + K W + E+ESTWE + L Sbjct: 225 IDERRTRNRVIHFCKVQWSNHSEEESTWEREDEL 258 >07_03_1567 - 27772815-27773302,27773471-27773561,27773641-27773988, 27774929-27775110,27775191-27775368,27775453-27775605, 27775993-27776232,27776369-27776449,27776485-27776730, 27777151-27777240,27777536-27777778,27778365-27778529, 27779017-27779080,27779162-27779286,27779383-27779476, 27779647-27779714,27779798-27779989,27780618-27780752, 27780847-27780934,27781014-27781107,27781484-27781547, 27781657-27781708,27781911-27782014,27782099-27782158, 27782687-27782770,27782892-27783125,27783442-27783864, 27784675-27784736,27784867-27785521 Length = 1700 Score = 28.7 bits (61), Expect = 1.8 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +2 Query: 179 QYLLKWKGYKEDESTWE 229 +YL+KW+G ESTWE Sbjct: 526 EYLVKWQGLPYAESTWE 542 >02_05_0491 + 29470575-29471351,29471574-29471806,29472697-29472856, 29473149-29473394,29473492-29473628,29473874-29474207, 29474283-29474444,29474717-29474791,29474866-29474966, 29475042-29475111,29475210-29475266,29475357-29475418, 29475505-29475577,29475663-29475884 Length = 902 Score = 28.7 bits (61), Expect = 1.8 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +2 Query: 80 GKKDKKTETSDGSSEEEFVVEKVLDKRTVKGKIQYLLKWKG 202 G +K + D S+ ++ V EKVL KRT + ++ + K G Sbjct: 596 GDANKSSAPIDESNAQDIVTEKVLKKRTFRVPLKVVEKMAG 636 >06_03_0557 + 22133604-22134506 Length = 300 Score = 28.3 bits (60), Expect = 2.4 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 140 EKVLDKRTVKGKIQYLLKWKGYKEDESTWEPVENLDCE 253 E+ ++T+K Y ++W + EDE+TWE + L E Sbjct: 260 ERQTRRKTIKF---YKVQWTNHSEDEATWEREDLLRAE 294 >08_02_0235 + 14627648-14628889 Length = 413 Score = 27.9 bits (59), Expect = 3.1 Identities = 12/42 (28%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +2 Query: 122 EEEFVVEKVLDKRTVKGKIQYL-LKWKGYKEDESTWEPVENL 244 E+ + ++ ++RT I++ ++W + E+ESTWE + L Sbjct: 352 EKPIRILEIDERRTRNRVIRFCKVQWSNHSEEESTWEREDEL 393 >07_01_1086 - 9930311-9931993 Length = 560 Score = 27.9 bits (59), Expect = 3.1 Identities = 12/42 (28%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +2 Query: 122 EEEFVVEKVLDKRTVKGKIQYL-LKWKGYKEDESTWEPVENL 244 E+ + ++ ++RT I++ ++W + E+ESTWE + L Sbjct: 499 EKPIRILEIDERRTRNRVIRFCKVQWSNHSEEESTWEREDEL 540 >12_02_0637 - 21437244-21438080 Length = 278 Score = 27.5 bits (58), Expect = 4.1 Identities = 12/42 (28%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +2 Query: 122 EEEFVVEKVLDKRTVKGKIQYL-LKWKGYKEDESTWEPVENL 244 E+ + + ++RT I++ ++W + E+ESTWE + L Sbjct: 217 EKPIRILETSERRTRNRVIRFCKVQWSNHSEEESTWEREDEL 258 >12_02_0141 + 14303418-14303687,14304447-14304586,14304744-14305569 Length = 411 Score = 27.5 bits (58), Expect = 4.1 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -1 Query: 221 CSHLLYNLSISINIVSFPSQYVYRELFQQQTL 126 CSH+L +++ +NI PS+Y+ + +Q TL Sbjct: 219 CSHILRVMAV-LNIHEIPSKYLLKRWSEQATL 249 >10_01_0300 - 3257584-3258825 Length = 413 Score = 27.5 bits (58), Expect = 4.1 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = +2 Query: 149 LDKRTVKGKIQYLLK--WKGYKEDESTWEPVENL 244 +D+R + ++ K W + E+ESTWE + L Sbjct: 360 IDERRTRNRVICFCKVQWSNHSEEESTWEREDEL 393 >03_05_0176 + 21546952-21547887,21548856-21548921,21549959-21550877, 21551277-21551449,21551927-21552475 Length = 880 Score = 27.5 bits (58), Expect = 4.1 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +1 Query: 286 RERKNKKTRRSWQKTCARVE*GNQYRKTRASY 381 R++KNK+T+R +K A+V +Q+ K R Y Sbjct: 803 RKKKNKRTQRRKRKQNAQVMKQHQFEKQRKLY 834 >11_01_0792 + 6679002-6679603,6738490-6738520,6738532-6739644 Length = 581 Score = 27.1 bits (57), Expect = 5.5 Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +2 Query: 152 DKRTVKGKIQYL-LKWKGYKEDESTWEPVENL 244 ++RT I++ ++W + E+ESTWE + L Sbjct: 530 ERRTRNRVIRFCKVQWSNHSEEESTWEREDEL 561 >10_05_0084 + 8956637-8956681,8957722-8957856,8958040-8958834 Length = 324 Score = 27.1 bits (57), Expect = 5.5 Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +2 Query: 152 DKRTVKGKIQYL-LKWKGYKEDESTWEPVENL 244 ++RT I++ ++W + E+ESTWE + L Sbjct: 273 ERRTRNRVIRFCKVQWSNHSEEESTWEREDEL 304 >04_01_0293 + 3881375-3883698,3906619-3907636,3907820-3908309, 3914729-3914823,3914854-3915213 Length = 1428 Score = 27.1 bits (57), Expect = 5.5 Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +2 Query: 152 DKRTVKGKIQYL-LKWKGYKEDESTWEPVENL 244 ++RT I++ ++W + E+ESTWE + L Sbjct: 1237 ERRTRNRVIRFCKVQWSNHSEEESTWEREDEL 1268 >11_03_0201 + 11578163-11578915 Length = 250 Score = 26.6 bits (56), Expect = 7.2 Identities = 10/33 (30%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = +2 Query: 152 DKRTVKGKIQ--YLLKWKGYKEDESTWEPVENL 244 ++R + K+ Y ++W + E+E+TWE + L Sbjct: 198 NERRTRNKVTRFYRVQWSHHSEEEATWEREDEL 230 >07_03_1512 + 27288779-27289222,27298101-27298399,27298499-27298589, 27298701-27298766,27299151-27302660,27311604-27312224 Length = 1676 Score = 26.6 bits (56), Expect = 7.2 Identities = 12/42 (28%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +2 Query: 122 EEEFVVEKVLDKRTVKGKIQYL-LKWKGYKEDESTWEPVENL 244 E+ + +V ++ T I++ ++W + E+ESTWE + L Sbjct: 1615 EKPVRILEVSERNTRNRVIRFCKVQWSNHSEEESTWEREDEL 1656 >06_02_0319 + 14306464-14306577,14306623-14307117 Length = 202 Score = 26.6 bits (56), Expect = 7.2 Identities = 11/42 (26%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +2 Query: 122 EEEFVVEKVLDKRTVKGKIQYL-LKWKGYKEDESTWEPVENL 244 E+ + +++RT I++ ++W + E+E+TWE + L Sbjct: 141 EKPVKILDTIERRTRNRVIRFCKVQWSNHAEEEATWEREDEL 182 >03_02_1029 - 13488535-13493037 Length = 1500 Score = 26.6 bits (56), Expect = 7.2 Identities = 11/42 (26%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +2 Query: 122 EEEFVVEKVLDKRTVKGKIQYL-LKWKGYKEDESTWEPVENL 244 E+ + +++RT I++ ++W + E+E+TWE + L Sbjct: 1439 EKPVKILDTMERRTRNRVIRFCKVQWSNHAEEEATWEREDEL 1480 >10_07_0032 + 12096290-12097042,12097056-12098066,12110194-12110454 Length = 674 Score = 26.2 bits (55), Expect = 9.5 Identities = 10/33 (30%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +2 Query: 149 LDKRTVKGKIQYL-LKWKGYKEDESTWEPVENL 244 +++RT I++ ++W + E+E+TWE + L Sbjct: 622 MERRTRNRVIRFCKVQWSNHAEEEATWEREDEL 654 >09_02_0555 - 10588685-10592038 Length = 1117 Score = 26.2 bits (55), Expect = 9.5 Identities = 10/33 (30%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +2 Query: 149 LDKRTVKGKIQYL-LKWKGYKEDESTWEPVENL 244 +++RT I++ ++W + E+E+TWE + L Sbjct: 1065 MERRTRNRVIRFCKVQWSNHAEEEATWEREDEL 1097 >06_03_1048 + 27146475-27146652,27146739-27146804,27146880-27146975, 27147073-27147152,27148165-27148209,27148326-27148420, 27148623-27148632 Length = 189 Score = 26.2 bits (55), Expect = 9.5 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -3 Query: 156 LSRTFSTTNSSSLDPSLVSV 97 LSR FSTT SSS D S+V V Sbjct: 48 LSRLFSTTPSSSGDSSMVVV 67 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,713,624 Number of Sequences: 37544 Number of extensions: 132435 Number of successful extensions: 459 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 458 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 682720236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -