BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_H15 (438 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0834 - 11630288-11630500,11630531-11630623,11630844-116310... 29 1.6 06_01_0837 - 6355315-6355342,6356185-6356361,6356579-6356662,635... 27 8.7 >03_02_0834 - 11630288-11630500,11630531-11630623,11630844-11631050, 11631301-11633089,11633817-11634145 Length = 876 Score = 29.1 bits (62), Expect = 1.6 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 4/70 (5%) Frame = +1 Query: 241 ESHDELLKAIDFPNDNVTKAVFTDLNQKVRSI--KGVDLKLANKVYIANGNELNDQFAVV 414 + HD LLK+ NDN+TK + NQ + + KG D K +KV N+Q + Sbjct: 467 KEHDTLLKSSVELNDNLTKTA-EERNQILECLKEKGGDNKALHKVIARLQRISNEQEKTI 525 Query: 415 S--RDVFNSE 438 + R FN+E Sbjct: 526 TGLRQGFNAE 535 >06_01_0837 - 6355315-6355342,6356185-6356361,6356579-6356662, 6356989-6357542,6358086-6358322 Length = 359 Score = 26.6 bits (56), Expect = 8.7 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -1 Query: 111 LEYSLWVDVTGQCQGREGKYGYYNLHV-VGD 22 L+ S W+DV Q +G G+Y LH+ +GD Sbjct: 103 LKESKWIDVIDQFKGILGQYSDLPLHIALGD 133 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.315 0.131 0.352 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,516,876 Number of Sequences: 37544 Number of extensions: 160122 Number of successful extensions: 291 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 291 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 823860276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -