BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_H12 (503 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. 228 3e-62 AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 23 1.8 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 23 1.8 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 7.3 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 9.6 >AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. Length = 126 Score = 228 bits (557), Expect = 3e-62 Identities = 102/126 (80%), Positives = 118/126 (93%) Frame = +2 Query: 86 MSWQDYVDKQLMASRCVSKAAIAGHDGNVWAKSEGFEISKDEVAKIVAGFENESLLTSGG 265 MS QDYVDKQL+ASRCV+KAAIAGHDGN+WAKSEGFE+SK+E+ K+V GFE + +LTS G Sbjct: 1 MSCQDYVDKQLLASRCVTKAAIAGHDGNLWAKSEGFEVSKEELTKLVQGFEEQDILTSSG 60 Query: 266 VTIAGTRYIYLSGTERIIRAKLGKVGVHCMKTQQAVVISLYEEPIQPQQAASVVEKLGDY 445 VT+AG RYIYLSGT+R+IRAKLGKVGVHCMKT QAVV+SLYE+PIQPQQAASVVEKLGDY Sbjct: 61 VTLAGNRYIYLSGTDRVIRAKLGKVGVHCMKTTQAVVVSLYEDPIQPQQAASVVEKLGDY 120 Query: 446 LITCGY 463 L++CGY Sbjct: 121 LVSCGY 126 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 23.0 bits (47), Expect = 1.8 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 295 PQRYRTYHTRKARQGRRALHEDTAS 369 PQR T TR + RAL DT + Sbjct: 40 PQRIHTVRTRGGNKKYRALRLDTGN 64 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 23.0 bits (47), Expect = 1.8 Identities = 9/24 (37%), Positives = 10/24 (41%) Frame = +2 Query: 98 DYVDKQLMASRCVSKAAIAGHDGN 169 D + L RC K G DGN Sbjct: 447 DVISGNLEKGRCTGKIVTVGSDGN 470 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.0 bits (42), Expect = 7.3 Identities = 6/12 (50%), Positives = 11/12 (91%) Frame = +2 Query: 347 HCMKTQQAVVIS 382 HC+ T+Q+VV++ Sbjct: 822 HCVTTEQSVVVT 833 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 20.6 bits (41), Expect = 9.6 Identities = 7/24 (29%), Positives = 16/24 (66%) Frame = -1 Query: 209 HLLIFRTLLTWPRHFRRDRQLLPL 138 HL+ ++ +L R F +DR+++ + Sbjct: 435 HLIEYKKMLKIKRLFGKDRKIMDM 458 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,263 Number of Sequences: 438 Number of extensions: 2590 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13864083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -