Samia BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0001_H11
         (345 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.           27   0.26 
L76038-1|AAC27383.1|  683|Anopheles gambiae prophenoloxidase pro...    22   7.4  
AF031626-1|AAD01936.1|  683|Anopheles gambiae prophenoloxidase p...    22   7.4  

>AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.
          Length = 1459

 Score = 26.6 bits (56), Expect = 0.26
 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 4/55 (7%)
 Frame = +2

Query: 2    HEGETTL*SDSSATSGRRYAFPVDSRCIXXXXXXXXXXXXTA--RSAGG--DCTT 154
            HE  TT      AT GR++ + V S C+            T+  R AG   +CT+
Sbjct: 1289 HERRTTADFGRKATDGRQHEYAVPSNCLLDTTHETYNTTATSCERIAGETFECTS 1343


>L76038-1|AAC27383.1|  683|Anopheles gambiae prophenoloxidase
           protein.
          Length = 683

 Score = 21.8 bits (44), Expect = 7.4
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +3

Query: 27  LTPRRQAAGDMH 62
           L+P RQ  GDMH
Sbjct: 353 LSPNRQLYGDMH 364


>AF031626-1|AAD01936.1|  683|Anopheles gambiae prophenoloxidase
           protein.
          Length = 683

 Score = 21.8 bits (44), Expect = 7.4
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +3

Query: 27  LTPRRQAAGDMH 62
           L+P RQ  GDMH
Sbjct: 353 LSPNRQLYGDMH 364


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 319,995
Number of Sequences: 2352
Number of extensions: 5632
Number of successful extensions: 6
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 563,979
effective HSP length: 57
effective length of database: 429,915
effective search space used: 24505155
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)