BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_H09 (586 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-... 23 2.2 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.2 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 2.2 M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-... 21 6.7 AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 21 8.9 >M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E60. ). Length = 109 Score = 23.0 bits (47), Expect = 2.2 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +2 Query: 398 GLTDGEVPRRLGPKRASKIRKLFNLKKEDDVRRYVVKR 511 G +G P P+ A +L LK+E RY+ +R Sbjct: 11 GRGNGGTPEEKRPRTAFSGEQLARLKREFAENRYLTER 48 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.0 bits (47), Expect = 2.2 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -2 Query: 276 EWPFDIKRRTRLLVRTPCFI 217 EWP +++R L + CF+ Sbjct: 406 EWPRLLRKRKELFIAIVCFV 425 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.0 bits (47), Expect = 2.2 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -2 Query: 276 EWPFDIKRRTRLLVRTPCFI 217 EWP +++R L + CF+ Sbjct: 459 EWPRLLRKRKELFIAIVCFV 478 >M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E30. ). Length = 109 Score = 21.4 bits (43), Expect = 6.7 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 419 PRRLGPKRASKIRKLFNLKKEDDVRRYVVKR 511 P P+ A +L LK+E RY+ +R Sbjct: 18 PEEKRPRTAFSAEQLARLKREFAENRYLTER 48 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/28 (25%), Positives = 14/28 (50%) Frame = -3 Query: 197 YRRQHGEHNLSIRRLEDLHQLQRPYAFH 114 Y RQH ++ + +E + + +R H Sbjct: 55 YHRQHSKNEQQRKEMEQMREREREQREH 82 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,494 Number of Sequences: 438 Number of extensions: 3492 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16993167 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -