BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_H08 (388 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q2U4U3 Cluster: Predicted protein; n=7; Trichocomaceae|... 33 1.9 UniRef50_Q7S4U0 Cluster: Predicted protein; n=1; Neurospora cras... 33 2.5 UniRef50_Q0U520 Cluster: Predicted protein; n=1; Phaeosphaeria n... 32 4.4 UniRef50_UPI00004D5000 Cluster: Apolipoprotein-L6 (Apolipoprotei... 31 5.8 >UniRef50_Q2U4U3 Cluster: Predicted protein; n=7; Trichocomaceae|Rep: Predicted protein - Aspergillus oryzae Length = 428 Score = 33.1 bits (72), Expect = 1.9 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 184 FARCIFLNDNTRE*LQFPFIFIRRPWCSPA-SYHH 83 F+ I N N E +F F RRPWC PA ++HH Sbjct: 269 FSWPILQNTNIGELDEFTTAFYRRPWCFPAVAFHH 303 >UniRef50_Q7S4U0 Cluster: Predicted protein; n=1; Neurospora crassa|Rep: Predicted protein - Neurospora crassa Length = 1272 Score = 32.7 bits (71), Expect = 2.5 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = +2 Query: 128 EGKLELFSGVVIEKDASGENKLNVKFEPGELREAARTFEEARGKIKKYT 274 +G L + G I+ DA G+ + V E + RE R EEAR K+K T Sbjct: 669 DGTLPMDMGPDIDMDADGDMDMCVDQETEKRRERERYLEEARLKVKDVT 717 >UniRef50_Q0U520 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 271 Score = 31.9 bits (69), Expect = 4.4 Identities = 16/55 (29%), Positives = 22/55 (40%) Frame = -3 Query: 188 CFRQMHLSQ*QHQRIAPVSLHLHSPPLVQPCKLPPCIIPNTIHAFSQNLL*SYPD 24 C + Q QHQ + H+HSP P PP ++P +N PD Sbjct: 30 CEHLCRIHQMQHQTPSAFYKHIHSPYATPPATPPPALLPRKRPPLRRNTTLPTPD 84 >UniRef50_UPI00004D5000 Cluster: Apolipoprotein-L6 (Apolipoprotein L-VI) (ApoL-VI).; n=1; Xenopus tropicalis|Rep: Apolipoprotein-L6 (Apolipoprotein L-VI) (ApoL-VI). - Xenopus tropicalis Length = 278 Score = 31.5 bits (68), Expect = 5.8 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = +2 Query: 119 NEDEGKLELFSGVVIEKDASGENKLNVKFEPGELREAARTFEEARGKIKKYTP 277 +E E K E G +E+D + K NVK + +L E +TF + G++++ P Sbjct: 3 SEQESKTERTIGTTLEEDTTLLKK-NVKLQCKDLEEKLKTFVKELGEVQETLP 54 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 336,656,093 Number of Sequences: 1657284 Number of extensions: 5473464 Number of successful extensions: 13054 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13048 length of database: 575,637,011 effective HSP length: 91 effective length of database: 424,824,167 effective search space used: 15718494179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -