BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_H08 (388 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z50739-2|CAA90602.2| 381|Caenorhabditis elegans Hypothetical pr... 27 6.1 AC024805-16|AAK39336.1| 448|Caenorhabditis elegans Hypothetical... 27 6.1 >Z50739-2|CAA90602.2| 381|Caenorhabditis elegans Hypothetical protein F13D2.3 protein. Length = 381 Score = 26.6 bits (56), Expect = 6.1 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = +3 Query: 279 SWLALVLRLLPWWPFSSVV*HY 344 S++ ++ RL+P+WPF +V+ HY Sbjct: 229 SYVRMMSRLIPFWPF-TVLNHY 249 >AC024805-16|AAK39336.1| 448|Caenorhabditis elegans Hypothetical protein Y51H7C.1 protein. Length = 448 Score = 26.6 bits (56), Expect = 6.1 Identities = 14/49 (28%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = -3 Query: 155 HQRIAPVSLHLHS-PPLVQPCKLPPCIIPNTIHAFSQNLL*SYPDCTLT 12 ++ + P S H + PP VQ PPC T + + P C T Sbjct: 186 YRTVPPASNHYETVPPAVQTTPQPPCTPRTTTTTTTTTTTTTLPPCVYT 234 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,689,344 Number of Sequences: 27780 Number of extensions: 128774 Number of successful extensions: 281 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 271 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 281 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 576961812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -