BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_H06 (647 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 27 0.39 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 25 1.6 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 24 3.6 AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease pr... 23 6.3 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 8.3 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 27.5 bits (58), Expect = 0.39 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -1 Query: 353 AME*GADATVGYPMDNESAATLATPA 276 A+ GA ATV PMD + A A PA Sbjct: 246 ALAAGAPATVSTPMDKDDPAAAAAPA 271 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 25.4 bits (53), Expect = 1.6 Identities = 17/69 (24%), Positives = 36/69 (52%), Gaps = 3/69 (4%) Frame = +1 Query: 127 VGASEATLLNMLNISPFS-YGLVVKQVYDSGT--IFAPAILDIKPEDLREKFLAGVANVA 297 VG +E+ +++N+ F+ Y + + +Y +G + A + +KPED+ A + Sbjct: 261 VGVTESA--DLINLEKFAQYAVAIAAMYKTGLGKLSEKATVKVKPEDVPLNLRAHDVSTH 318 Query: 298 ALSLSIGYP 324 +++LS P Sbjct: 319 SMTLSWAPP 327 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 24.2 bits (50), Expect = 3.6 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 192 CQTGVRLRYHLRAGNSRHQAGGPSREVPC 278 C R + LR G+ H+A G + EV C Sbjct: 479 CTGEDRSKRCLRCGDQTHKASGCTNEVKC 507 >AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease protein. Length = 435 Score = 23.4 bits (48), Expect = 6.3 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +3 Query: 270 VPCWSGQRGRALVVHRVPDGRVCA 341 +P WS Q + + V+R+ + +CA Sbjct: 348 IPIWSNQECQEVYVNRIYNTTLCA 371 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 8.3 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = +3 Query: 186 SCCQTGVRLRYHLRAGNSRHQAGGPSREVPCW 281 SC +L Y L A ++RH + + C+ Sbjct: 52 SCSDNAAQLTYRLPALSNRHNDNATAEYLSCY 83 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 629,770 Number of Sequences: 2352 Number of extensions: 11191 Number of successful extensions: 22 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -