BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_H04 (552 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 24 2.9 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 6.7 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 24.2 bits (50), Expect = 2.9 Identities = 14/68 (20%), Positives = 37/68 (54%), Gaps = 6/68 (8%) Frame = +3 Query: 57 ISRYLANKCSIASRIDCFSEVQSSVFG------EKLRQQVEDRLKFYETGDIPKKNIEVM 218 +S + + ++ + +D F++VQ+++ + L Q + + E D+PKKN + + Sbjct: 368 VSAKESKESTLKNSLDKFAKVQANMRATNERRKKTLEQIAAEEKRLLELQDVPKKNKKEI 427 Query: 219 KEAMDELQ 242 +E+ +++ Sbjct: 428 EESEAKIE 435 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.0 bits (47), Expect = 6.7 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +3 Query: 135 GEKLRQQVEDRLKFYETGDIPKKN-IEVMKEAMD 233 GE RQQ +DR + ++ +KN +E ++ A D Sbjct: 283 GEMRRQQEQDRAALEASKEMRRKNALEAIRMAED 316 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 385,649 Number of Sequences: 2352 Number of extensions: 6597 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51301854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -