BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_H02 (519 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 24 0.93 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 24 0.93 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 24 0.93 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 24 0.93 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 24 0.93 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 24 0.93 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 24 0.93 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 24 0.93 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 1.6 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 5.0 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 6.5 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 21 8.7 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 8.7 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.8 bits (49), Expect = 0.93 Identities = 13/55 (23%), Positives = 22/55 (40%) Frame = +3 Query: 354 HRITPEEAKYKLCNVRRVATGPKSVPYLVTHDGRTLRYPDPLINVNDSVQLDIST 518 H + P Y +R+A+ P TH + +Y D + + D+ST Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.8 bits (49), Expect = 0.93 Identities = 13/55 (23%), Positives = 22/55 (40%) Frame = +3 Query: 354 HRITPEEAKYKLCNVRRVATGPKSVPYLVTHDGRTLRYPDPLINVNDSVQLDIST 518 H + P Y +R+A+ P TH + +Y D + + D+ST Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 23.8 bits (49), Expect = 0.93 Identities = 13/55 (23%), Positives = 22/55 (40%) Frame = +3 Query: 354 HRITPEEAKYKLCNVRRVATGPKSVPYLVTHDGRTLRYPDPLINVNDSVQLDIST 518 H + P Y +R+A+ P TH + +Y D + + D+ST Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.8 bits (49), Expect = 0.93 Identities = 13/55 (23%), Positives = 22/55 (40%) Frame = +3 Query: 354 HRITPEEAKYKLCNVRRVATGPKSVPYLVTHDGRTLRYPDPLINVNDSVQLDIST 518 H + P Y +R+A+ P TH + +Y D + + D+ST Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 23.8 bits (49), Expect = 0.93 Identities = 13/55 (23%), Positives = 22/55 (40%) Frame = +3 Query: 354 HRITPEEAKYKLCNVRRVATGPKSVPYLVTHDGRTLRYPDPLINVNDSVQLDIST 518 H + P Y +R+A+ P TH + +Y D + + D+ST Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 23.8 bits (49), Expect = 0.93 Identities = 13/55 (23%), Positives = 22/55 (40%) Frame = +3 Query: 354 HRITPEEAKYKLCNVRRVATGPKSVPYLVTHDGRTLRYPDPLINVNDSVQLDIST 518 H + P Y +R+A+ P TH + +Y D + + D+ST Sbjct: 20 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 74 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 23.8 bits (49), Expect = 0.93 Identities = 13/55 (23%), Positives = 22/55 (40%) Frame = +3 Query: 354 HRITPEEAKYKLCNVRRVATGPKSVPYLVTHDGRTLRYPDPLINVNDSVQLDIST 518 H + P Y +R+A+ P TH + +Y D + + D+ST Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 23.8 bits (49), Expect = 0.93 Identities = 13/55 (23%), Positives = 22/55 (40%) Frame = +3 Query: 354 HRITPEEAKYKLCNVRRVATGPKSVPYLVTHDGRTLRYPDPLINVNDSVQLDIST 518 H + P Y +R+A+ P TH + +Y D + + D+ST Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 23.0 bits (47), Expect = 1.6 Identities = 13/55 (23%), Positives = 21/55 (38%) Frame = +3 Query: 354 HRITPEEAKYKLCNVRRVATGPKSVPYLVTHDGRTLRYPDPLINVNDSVQLDIST 518 H + P Y +R+A P TH + +Y D + + D+ST Sbjct: 64 HGLQPTMGDYTQLQPQRLAPTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.4 bits (43), Expect = 5.0 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +3 Query: 12 LFNMARGPKKHLKRLNAPKAWMLDKLG 92 + + R P +++K++N A LD+ G Sbjct: 606 VIGIGRSPDQNVKKINLKHALDLDRQG 632 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.0 bits (42), Expect = 6.5 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +3 Query: 21 MARGPKKHLKRLNAPKAWMLDKLG 92 + R P +++K++N A LD+ G Sbjct: 609 IGRSPDQNVKKINLKHALDLDRRG 632 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 20.6 bits (41), Expect = 8.7 Identities = 6/13 (46%), Positives = 7/13 (53%) Frame = +1 Query: 79 WTSWAACTRRGPR 117 W +W CTR R Sbjct: 190 WPAWVYCTRYSDR 202 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 20.6 bits (41), Expect = 8.7 Identities = 6/16 (37%), Positives = 13/16 (81%) Frame = +3 Query: 186 LTGNEVLKIVKQRLIK 233 L N++LK++++ L+K Sbjct: 392 LQQNKILKVIRKNLVK 407 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,541 Number of Sequences: 336 Number of extensions: 2651 Number of successful extensions: 13 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12468463 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -