Samia BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0001_H01
         (582 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1093.03 |||inositol polyphosphate phosphatase |Schizosacchar...    25   6.1  

>SPAC1093.03 |||inositol polyphosphate phosphatase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 832

 Score = 25.4 bits (53), Expect = 6.1
 Identities = 10/33 (30%), Positives = 21/33 (63%)
 Frame = -3

Query: 259 YSQTSRGSVNAFKKYHDYSGFDEKRKKIVILFI 161
           +S TSR  + + K+++  S  D +R++ + LF+
Sbjct: 507 WSSTSRDLIESVKRFYSNSFVDFQRQEAISLFL 539


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,193,568
Number of Sequences: 5004
Number of extensions: 41873
Number of successful extensions: 104
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 103
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 104
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 250133048
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)