Samia BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0001_H01
         (582 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022)                   29   3.7  

>SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022)
          Length = 270

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 15/42 (35%), Positives = 26/42 (61%)
 Frame = -3

Query: 295 IVDNKTVINKLNYSQTSRGSVNAFKKYHDYSGFDEKRKKIVI 170
           +VD+ T+INKL+    S  S+N FK Y      +++++K+ I
Sbjct: 33  LVDHDTLINKLSIYGVSGKSLNWFKSY-----LEDRKQKVTI 69


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,464,239
Number of Sequences: 59808
Number of extensions: 278976
Number of successful extensions: 622
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 552
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 622
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1397989795
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)