BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_G23 (474 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5219| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.092 SB_12655| Best HMM Match : Astacin (HMM E-Value=0) 29 2.6 >SB_5219| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 33.5 bits (73), Expect = 0.092 Identities = 15/48 (31%), Positives = 28/48 (58%) Frame = -2 Query: 404 SNCERYQRINEKKMIYFFTK*TYKVKRDSIRNSMITVGIENKIYKLYE 261 S+ ++Y + + YF+TK K KR+S ++ +I G ++K Y + E Sbjct: 72 SSSKKYMGLKRRSFAYFYTKLKRKSKRNSSQSVLIDDGQDHKYYAIKE 119 >SB_12655| Best HMM Match : Astacin (HMM E-Value=0) Length = 482 Score = 28.7 bits (61), Expect = 2.6 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 157 YSATIVHENRSRLNFEHE*VRIDGPLYIKFLFL*ISYNLYILFSI 291 Y T++HE L F HE R D Y+K L+ I + F++ Sbjct: 346 YRGTVMHELMHALGFFHEHSRHDRDKYVKILWWNIEPGFFNNFNV 390 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,015,570 Number of Sequences: 59808 Number of extensions: 247801 Number of successful extensions: 795 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 795 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 994359969 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -