BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_G23 (474 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC017731-1|AAH17731.1| 887|Homo sapiens oxysterol binding prote... 31 1.5 AY008372-1|AAG23400.1| 887|Homo sapiens oxysterol binding prote... 31 1.5 AF491784-1|AAM27389.1| 820|Homo sapiens oxysterol binding prote... 31 1.5 AF491783-1|AAM27388.1| 851|Homo sapiens oxysterol binding prote... 31 1.5 AF491782-1|AAM27387.1| 856|Homo sapiens oxysterol binding prote... 31 1.5 AF491781-1|AAM27386.1| 887|Homo sapiens oxysterol binding prote... 31 1.5 AF392444-1|AAL40657.1| 887|Homo sapiens oxysterol-binding prote... 31 1.5 AB014604-1|BAA31679.2| 919|Homo sapiens KIAA0704 protein protein. 31 1.5 X83378-1|CAA58292.1| 869|Homo sapiens putative chloride channel... 29 8.2 D28475-1|BAA05836.4| 872|Homo sapiens KIAA0046 protein. 29 8.2 BC117424-1|AAI17425.1| 869|Homo sapiens chloride channel 6 prot... 29 8.2 BC117420-1|AAI17421.1| 869|Homo sapiens chloride channel 6 prot... 29 8.2 AL953897-20|CAI15895.1| 869|Homo sapiens chloride channel 6 pro... 29 8.2 AL953897-19|CAI15894.1| 953|Homo sapiens chloride channel 6 pro... 29 8.2 AL021155-11|CAI23406.1| 869|Homo sapiens chloride channel 6 pro... 29 8.2 AL021155-10|CAI23405.1| 953|Homo sapiens chloride channel 6 pro... 29 8.2 AF009257-1|AAB69287.1| 869|Homo sapiens putative chloride chann... 29 8.2 >BC017731-1|AAH17731.1| 887|Homo sapiens oxysterol binding protein-like 3 protein. Length = 887 Score = 31.5 bits (68), Expect = 1.5 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 129 PLGNTRATL-VFGDHRPRKSITSELRARISTDRWAALY 239 P+G T TL VFGDH +TS + +S RW Y Sbjct: 666 PIGTTHVTLPVFGDHFEWNKVTSCIHNILSGQRWIEHY 703 >AY008372-1|AAG23400.1| 887|Homo sapiens oxysterol binding protein-related protein 3 protein. Length = 887 Score = 31.5 bits (68), Expect = 1.5 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 129 PLGNTRATL-VFGDHRPRKSITSELRARISTDRWAALY 239 P+G T TL VFGDH +TS + +S RW Y Sbjct: 666 PIGTTHVTLPVFGDHFEWNKVTSCIHNILSGQRWIEHY 703 >AF491784-1|AAM27389.1| 820|Homo sapiens oxysterol binding protein-related protein 3 isoform 1d protein. Length = 820 Score = 31.5 bits (68), Expect = 1.5 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 129 PLGNTRATL-VFGDHRPRKSITSELRARISTDRWAALY 239 P+G T TL VFGDH +TS + +S RW Y Sbjct: 599 PIGTTHVTLPVFGDHFEWNKVTSCIHNILSGQRWIEHY 636 >AF491783-1|AAM27388.1| 851|Homo sapiens oxysterol binding protein-related protein 3 isoform 1c protein. Length = 851 Score = 31.5 bits (68), Expect = 1.5 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 129 PLGNTRATL-VFGDHRPRKSITSELRARISTDRWAALY 239 P+G T TL VFGDH +TS + +S RW Y Sbjct: 630 PIGTTHVTLPVFGDHFEWNKVTSCIHNILSGQRWIEHY 667 >AF491782-1|AAM27387.1| 856|Homo sapiens oxysterol binding protein-related protein 3 isoform 1b protein. Length = 856 Score = 31.5 bits (68), Expect = 1.5 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 129 PLGNTRATL-VFGDHRPRKSITSELRARISTDRWAALY 239 P+G T TL VFGDH +TS + +S RW Y Sbjct: 635 PIGTTHVTLPVFGDHFEWNKVTSCIHNILSGQRWIEHY 672 >AF491781-1|AAM27386.1| 887|Homo sapiens oxysterol binding protein-related protein 3 isoform 1a protein. Length = 887 Score = 31.5 bits (68), Expect = 1.5 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 129 PLGNTRATL-VFGDHRPRKSITSELRARISTDRWAALY 239 P+G T TL VFGDH +TS + +S RW Y Sbjct: 666 PIGTTHVTLPVFGDHFEWNKVTSCIHNILSGQRWIEHY 703 >AF392444-1|AAL40657.1| 887|Homo sapiens oxysterol-binding protein-like protein OSBPL3 protein. Length = 887 Score = 31.5 bits (68), Expect = 1.5 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 129 PLGNTRATL-VFGDHRPRKSITSELRARISTDRWAALY 239 P+G T TL VFGDH +TS + +S RW Y Sbjct: 666 PIGTTHVTLPVFGDHFEWNKVTSCIHNILSGQRWIEHY 703 >AB014604-1|BAA31679.2| 919|Homo sapiens KIAA0704 protein protein. Length = 919 Score = 31.5 bits (68), Expect = 1.5 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 129 PLGNTRATL-VFGDHRPRKSITSELRARISTDRWAALY 239 P+G T TL VFGDH +TS + +S RW Y Sbjct: 698 PIGTTHVTLPVFGDHFEWNKVTSCIHNILSGQRWIEHY 735 >X83378-1|CAA58292.1| 869|Homo sapiens putative chloride channel protein. Length = 869 Score = 29.1 bits (62), Expect = 8.2 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 166 SPNTSVARVFPSGRTAGLRH 107 SPNT V++VF RT GLRH Sbjct: 815 SPNTHVSQVFNLFRTMGLRH 834 >D28475-1|BAA05836.4| 872|Homo sapiens KIAA0046 protein. Length = 872 Score = 29.1 bits (62), Expect = 8.2 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 166 SPNTSVARVFPSGRTAGLRH 107 SPNT V++VF RT GLRH Sbjct: 818 SPNTHVSQVFNLFRTMGLRH 837 >BC117424-1|AAI17425.1| 869|Homo sapiens chloride channel 6 protein. Length = 869 Score = 29.1 bits (62), Expect = 8.2 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 166 SPNTSVARVFPSGRTAGLRH 107 SPNT V++VF RT GLRH Sbjct: 815 SPNTHVSQVFNLFRTMGLRH 834 >BC117420-1|AAI17421.1| 869|Homo sapiens chloride channel 6 protein. Length = 869 Score = 29.1 bits (62), Expect = 8.2 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 166 SPNTSVARVFPSGRTAGLRH 107 SPNT V++VF RT GLRH Sbjct: 815 SPNTHVSQVFNLFRTMGLRH 834 >AL953897-20|CAI15895.1| 869|Homo sapiens chloride channel 6 protein. Length = 869 Score = 29.1 bits (62), Expect = 8.2 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 166 SPNTSVARVFPSGRTAGLRH 107 SPNT V++VF RT GLRH Sbjct: 815 SPNTHVSQVFNLFRTMGLRH 834 >AL953897-19|CAI15894.1| 953|Homo sapiens chloride channel 6 protein. Length = 953 Score = 29.1 bits (62), Expect = 8.2 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 166 SPNTSVARVFPSGRTAGLRH 107 SPNT V++VF RT GLRH Sbjct: 815 SPNTHVSQVFNLFRTMGLRH 834 >AL021155-11|CAI23406.1| 869|Homo sapiens chloride channel 6 protein. Length = 869 Score = 29.1 bits (62), Expect = 8.2 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 166 SPNTSVARVFPSGRTAGLRH 107 SPNT V++VF RT GLRH Sbjct: 815 SPNTHVSQVFNLFRTMGLRH 834 >AL021155-10|CAI23405.1| 953|Homo sapiens chloride channel 6 protein. Length = 953 Score = 29.1 bits (62), Expect = 8.2 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 166 SPNTSVARVFPSGRTAGLRH 107 SPNT V++VF RT GLRH Sbjct: 815 SPNTHVSQVFNLFRTMGLRH 834 >AF009257-1|AAB69287.1| 869|Homo sapiens putative chloride channel protein. Length = 869 Score = 29.1 bits (62), Expect = 8.2 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 166 SPNTSVARVFPSGRTAGLRH 107 SPNT V++VF RT GLRH Sbjct: 815 SPNTHVSQVFNLFRTMGLRH 834 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 59,269,767 Number of Sequences: 237096 Number of extensions: 1146235 Number of successful extensions: 2111 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 2076 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2111 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4156838854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -