BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_G22 (555 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 218 3e-57 SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 174 3e-44 SB_54786| Best HMM Match : Ribosomal_S12 (HMM E-Value=1.4e-12) 36 0.029 SB_46453| Best HMM Match : DUF947 (HMM E-Value=0.13) 30 1.1 SB_19664| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_49238| Best HMM Match : Metallothionein (HMM E-Value=2.8) 28 5.9 SB_34124| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_2709| Best HMM Match : SBP (HMM E-Value=0.83) 27 7.8 SB_48550| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_41748| Best HMM Match : Transposase_14 (HMM E-Value=0.79) 27 7.8 >SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 413 Score = 218 bits (532), Expect = 3e-57 Identities = 97/116 (83%), Positives = 109/116 (93%) Frame = +3 Query: 39 KPRGIRTARKHVNHRREQRWADKEFKKAHMGTRWKANPFGGASHAKGIVLEKVGVEAKQP 218 KPRG+RTARK +HRR+Q+W DK +KKAH+GT KANPFGGASHAKGIVLEKVGVEAKQP Sbjct: 2 KPRGLRTARKLRSHRRDQKWHDKAYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQP 61 Query: 219 NSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGV 386 NSAIRKCVRVQLIKNGKK+TAFVP DGCLN+IEENDEVL++GFGR+GHAVGDIPG+ Sbjct: 62 NSAIRKCVRVQLIKNGKKITAFVPNDGCLNYIEENDEVLISGFGRRGHAVGDIPGI 117 >SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 143 Score = 174 bits (424), Expect = 3e-44 Identities = 80/91 (87%), Positives = 89/91 (97%) Frame = +3 Query: 189 EKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAV 368 ++ GVEAKQPNSAIRKCVRVQLIKNGKK+TAFVP DGCLN+IEENDEVL++GFGR+GHAV Sbjct: 53 QEPGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNYIEENDEVLISGFGRRGHAV 112 Query: 369 GDIPGVRFKVVKVANVSLLALYKEQKERPRS 461 GDIPGVRFKVVKVANVSLLAL+KE+KERPRS Sbjct: 113 GDIPGVRFKVVKVANVSLLALFKEKKERPRS 143 >SB_54786| Best HMM Match : Ribosomal_S12 (HMM E-Value=1.4e-12) Length = 302 Score = 35.5 bits (78), Expect = 0.029 Identities = 16/39 (41%), Positives = 27/39 (69%) Frame = +3 Query: 174 KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVP 290 KG+ ++ + K+PNSA RKC ++L NGK ++A++P Sbjct: 230 KGVCVKVFIRKPKKPNSAQRKCALLKL-SNGKTISAYIP 267 >SB_46453| Best HMM Match : DUF947 (HMM E-Value=0.13) Length = 943 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 2/26 (7%) Frame = -3 Query: 163 APPKGFAFHLVPMW-AFLN-SLSAHR 92 APPKG+ F +VP+W +F N S+ HR Sbjct: 911 APPKGYRFLIVPLWRSFSNRSVFGHR 936 >SB_19664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 632 Score = 28.7 bits (61), Expect = 3.4 Identities = 17/66 (25%), Positives = 28/66 (42%) Frame = -3 Query: 391 NLTPGMSPTAWPLRPNPATNTSSFSSMWLRQPSRGTNAVTFLPFLMSCTRTHLRMAEFGC 212 N TP + P T+TSS + P++GT + P + T T L + C Sbjct: 476 NPTPSVESDDMDYIPTKDTSTSSTGNQCSSVPTKGTKPMRPPPGFHALTTTQLTKTDDAC 535 Query: 211 LASTPT 194 ++P+ Sbjct: 536 EPNSPS 541 >SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2848 Score = 28.3 bits (60), Expect = 4.5 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = -1 Query: 543 TQYKMYTYKQDASRRRQRVTHLSQCKPMTWASPSVLCTELEATRLL 406 T+ Y Y+Q+A RR T L+Q K S + L E+E+ + + Sbjct: 2001 TRSMRYKYEQEAEARRVSETLLNQLKEQIKRSDAKLAKEMESRQAM 2046 >SB_49238| Best HMM Match : Metallothionein (HMM E-Value=2.8) Length = 293 Score = 27.9 bits (59), Expect = 5.9 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -3 Query: 370 PTAWPLRPNPATNTSSFSSMWLRQPSRGTNA-VTFL 266 P W PN T S WL QP++GT+A VT+L Sbjct: 138 PCTWLAPPNKGT---SAPVTWLAQPNKGTSAPVTWL 170 Score = 27.5 bits (58), Expect = 7.8 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 373 SPTAWPLRPNPATNTSSFSSMWLRQPSRGTNAV 275 +P W +PN T S WL P++GT+A+ Sbjct: 151 APVTWLAQPNKGT---SAPVTWLAPPNKGTSAI 180 >SB_34124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 27.9 bits (59), Expect = 5.9 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 116 KSPHGYEMEGEPLRWCISC*GHRPRKS 196 +S HG MEG P+ W +S G P+ S Sbjct: 84 RSQHGTRMEGVPVCWYVSVWGLSPQVS 110 >SB_2709| Best HMM Match : SBP (HMM E-Value=0.83) Length = 154 Score = 27.5 bits (58), Expect = 7.8 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -3 Query: 157 PKGFAFHLVPMWAFLNSLS 101 PKG+ F +VP+W+ L + S Sbjct: 10 PKGYRFQIVPLWSSLTNRS 28 >SB_48550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 595 Score = 27.5 bits (58), Expect = 7.8 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 59 GAQARESSSRAAMGRQGIQKS 121 G QARE++ R AM RQG++ + Sbjct: 2 GRQARENTFRRAMSRQGLENT 22 Score = 27.5 bits (58), Expect = 7.8 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 59 GAQARESSSRAAMGRQGIQKS 121 G QARE++ R AM RQG++ + Sbjct: 281 GRQARENTFRRAMSRQGLENT 301 >SB_41748| Best HMM Match : Transposase_14 (HMM E-Value=0.79) Length = 270 Score = 27.5 bits (58), Expect = 7.8 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -3 Query: 157 PKGFAFHLVPMWAFLNSLS 101 PKG+ F +VP+W+ L + S Sbjct: 10 PKGYRFQIVPLWSSLTNRS 28 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,582,184 Number of Sequences: 59808 Number of extensions: 444489 Number of successful extensions: 1714 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1709 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1288581898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -