BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_G21 (437 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40414-1|AAA81404.2| 543|Caenorhabditis elegans Hypothetical pr... 29 1.5 >U40414-1|AAA81404.2| 543|Caenorhabditis elegans Hypothetical protein F53B3.1 protein. Length = 543 Score = 29.1 bits (62), Expect = 1.5 Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 1/74 (1%) Frame = +1 Query: 193 IKFDLTIECCELIVNKLMYTSRDAGTVYVCY-VTPSRHIYSTDPHKMLNTFCQRYRKGPN 369 ++F ++C + + N + D YVC+ TP R++ TD +++LN +++ +G N Sbjct: 354 VEFQQCLKCFKCVENDAEMANHDCELTYVCFECTPIRNL-CTD-NRLLN-HRKKFHRGAN 410 Query: 370 RIYIMTTDNLN*LT 411 + + N+ LT Sbjct: 411 SGFRCSFCNMKFLT 424 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,299,130 Number of Sequences: 27780 Number of extensions: 147798 Number of successful extensions: 374 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 374 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 745968860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -