BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_G12 (448 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 26 0.53 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 25 1.6 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 24 2.1 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 6.5 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 6.5 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 23 6.5 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 23 6.5 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 23 6.5 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 6.5 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 23 6.5 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 23 6.5 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 23 6.5 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 23 6.5 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 23 6.5 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 23 6.5 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 23 6.5 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 22 8.6 L07880-1|AAA29358.1| 218|Anopheles gambiae glutathione S-transf... 22 8.6 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 22 8.6 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 22 8.6 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 22 8.6 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 22 8.6 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 22 8.6 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 22 8.6 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 26.2 bits (55), Expect = 0.53 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +2 Query: 59 C*NLRLRSILITR-APPTLTRTTMNRSKKKNPLRVLMKMTTVWWVMTLPL 205 C ++RL T+ T R +R +KK R+L+ M ++ + LPL Sbjct: 290 CVSIRLNDRARTKPGSKTSRREEADRDRKKRTNRMLISMVAIFGISWLPL 339 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 24.6 bits (51), Expect = 1.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +1 Query: 70 PPQIDSHYSRAADAHSHDHEQEQKEEPTQGPYEDDDG 180 P + + DA + D E+E++EE + ED++G Sbjct: 950 PDGLQKEVKKEVDA-AEDDEEEEEEEQEEEEDEDEEG 985 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 24.2 bits (50), Expect = 2.1 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +1 Query: 121 DHEQEQKEEPTQGPYEDDDGMVGDDP 198 +++ E + +P + E D+G+ DDP Sbjct: 1350 ENQNEDEVQPMEVEEERDEGVAADDP 1375 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 22.6 bits (46), Expect = 6.5 Identities = 11/39 (28%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +3 Query: 273 RHRTFRPRQR-HAGTSRLLKSDSMVASVSLLPLIRYEVY 386 +H R + R H G+ + S + + P+I YE+Y Sbjct: 731 KHGQVRIQLRDHLGSDTVAVDGSSIPPLGKFPVIHYEMY 769 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 22.6 bits (46), Expect = 6.5 Identities = 11/39 (28%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +3 Query: 273 RHRTFRPRQR-HAGTSRLLKSDSMVASVSLLPLIRYEVY 386 +H R + R H G+ + S + + P+I YE+Y Sbjct: 732 KHGQVRIQLRDHLGSDTVAVDGSSIPPLGKFPVIHYEMY 770 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 22.6 bits (46), Expect = 6.5 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = -1 Query: 211 IDKRQGHHPPYRRHLHKDPEWVLLFAPVH 125 +D HH + + ++P V + PVH Sbjct: 134 VDYHADHHTGFNAVVRREPSAVKIAQPVH 162 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 22.6 bits (46), Expect = 6.5 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = -1 Query: 211 IDKRQGHHPPYRRHLHKDPEWVLLFAPVH 125 +D HH + + ++P V + PVH Sbjct: 126 VDYHADHHTGFNAVVRREPSAVKIAQPVH 154 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 22.6 bits (46), Expect = 6.5 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = -1 Query: 211 IDKRQGHHPPYRRHLHKDPEWVLLFAPVH 125 +D HH + + ++P V + PVH Sbjct: 126 VDYHADHHTGFNAVVRREPSAVKIAQPVH 154 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 22.6 bits (46), Expect = 6.5 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = -1 Query: 211 IDKRQGHHPPYRRHLHKDPEWVLLFAPVH 125 +D HH + + ++P V + PVH Sbjct: 126 VDYHADHHTGFNAVVRREPSAVKIAQPVH 154 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 22.6 bits (46), Expect = 6.5 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = -1 Query: 211 IDKRQGHHPPYRRHLHKDPEWVLLFAPVH 125 +D HH + + ++P V + PVH Sbjct: 134 VDYHADHHTGFNAVVRREPSAVKIAQPVH 162 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 22.6 bits (46), Expect = 6.5 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = -1 Query: 211 IDKRQGHHPPYRRHLHKDPEWVLLFAPVH 125 +D HH + + ++P V + PVH Sbjct: 126 VDYHADHHTGFNAVVRREPSAVKIAQPVH 154 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 22.6 bits (46), Expect = 6.5 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = -1 Query: 211 IDKRQGHHPPYRRHLHKDPEWVLLFAPVH 125 +D HH + + ++P V + PVH Sbjct: 134 VDYHADHHTGFNAVVRREPSAVKIAQPVH 162 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 22.6 bits (46), Expect = 6.5 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = -1 Query: 211 IDKRQGHHPPYRRHLHKDPEWVLLFAPVH 125 +D HH + + ++P V + PVH Sbjct: 158 VDYHADHHTGFNAVVRREPSAVKIAQPVH 186 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 22.6 bits (46), Expect = 6.5 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = -1 Query: 211 IDKRQGHHPPYRRHLHKDPEWVLLFAPVH 125 +D HH + + ++P V + PVH Sbjct: 126 VDYHADHHTGFNAVVRREPSAVKIAQPVH 154 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 22.6 bits (46), Expect = 6.5 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = -1 Query: 211 IDKRQGHHPPYRRHLHKDPEWVLLFAPVH 125 +D HH + + ++P V + PVH Sbjct: 126 VDYHADHHTGFNAVVRREPSAVKIAQPVH 154 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 22.6 bits (46), Expect = 6.5 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = -1 Query: 211 IDKRQGHHPPYRRHLHKDPEWVLLFAPVH 125 +D HH + + ++P V + PVH Sbjct: 134 VDYHADHHTGFNAVVRREPSAVKIAQPVH 162 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 22.2 bits (45), Expect = 8.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 357 LLPLIRYEVYQKYYFN 404 +LP I YE+Y Y+FN Sbjct: 158 VLPAI-YEIYPYYFFN 172 >L07880-1|AAA29358.1| 218|Anopheles gambiae glutathione S-transferase protein. Length = 218 Score = 22.2 bits (45), Expect = 8.6 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +3 Query: 384 YQKYYFNVKA 413 Y+ YYFNVKA Sbjct: 19 YKVYYFNVKA 28 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 22.2 bits (45), Expect = 8.6 Identities = 8/36 (22%), Positives = 14/36 (38%) Frame = +1 Query: 55 AMLKSPPQIDSHYSRAADAHSHDHEQEQKEEPTQGP 162 A + P +S H+Q+ + +P GP Sbjct: 458 AFFRGPDSGTDRHSEKQQQQQSQHQQQHQHQPGGGP 493 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 22.2 bits (45), Expect = 8.6 Identities = 8/36 (22%), Positives = 14/36 (38%) Frame = +1 Query: 55 AMLKSPPQIDSHYSRAADAHSHDHEQEQKEEPTQGP 162 A + P +S H+Q+ + +P GP Sbjct: 458 AFFRGPDSGTDRHSEKQQQQQSQHQQQHQHQPGGGP 493 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 22.2 bits (45), Expect = 8.6 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = -1 Query: 211 IDKRQGHHPPYRRHLHKDPEWVLLFAPVH 125 +D HH + + ++P V + PVH Sbjct: 134 VDYHADHHTGFNAVVRREPSAVKIAHPVH 162 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 22.2 bits (45), Expect = 8.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 357 LLPLIRYEVYQKYYFN 404 +LP I YE+Y Y+FN Sbjct: 158 VLPAI-YEIYPYYFFN 172 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 22.2 bits (45), Expect = 8.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 357 LLPLIRYEVYQKYYFN 404 +LP I YE+Y Y+FN Sbjct: 158 VLPAI-YEIYPYYFFN 172 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 22.2 bits (45), Expect = 8.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 357 LLPLIRYEVYQKYYFN 404 +LP I YE+Y Y+FN Sbjct: 158 VLPAI-YEIYPYYFFN 172 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 385,399 Number of Sequences: 2352 Number of extensions: 6194 Number of successful extensions: 31 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37843779 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -