BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_G12 (448 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77920.1 68414.m09080 bZIP family transcription factor contai... 42 1e-04 At4g02810.1 68417.m00381 expressed protein 30 0.82 At2g32010.1 68415.m03911 endonuclease/exonuclease/phosphatase fa... 30 0.82 At1g03350.1 68414.m00314 BSD domain-containing protein contains ... 30 0.82 At5g66840.1 68418.m08427 SAP domain-containing protein contains ... 29 1.9 At3g56590.1 68416.m06293 hydroxyproline-rich glycoprotein family... 29 1.9 At1g55080.1 68414.m06291 expressed protein 29 1.9 At4g37270.1 68417.m05275 cadmium/zinc-transporting ATPase, putat... 28 2.5 At3g17170.1 68416.m02190 ribosomal protein S6 family protein (RF... 28 2.5 At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to ... 28 3.3 At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to ... 28 3.3 At4g27310.1 68417.m03918 zinc finger (B-box type) family protein... 27 5.8 At3g01260.1 68416.m00032 aldose 1-epimerase family protein simil... 27 5.8 At1g22610.1 68414.m02823 C2 domain-containing protein contains I... 27 5.8 At5g60760.1 68418.m07623 2-phosphoglycerate kinase-related conta... 27 7.6 At3g25100.1 68416.m03135 cell division control protein-related c... 27 7.6 >At1g77920.1 68414.m09080 bZIP family transcription factor contains Pfam profile: PF00170 bZIP transcription factor Length = 368 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/53 (32%), Positives = 30/53 (56%) Frame = +1 Query: 34 SPHLKTSAMLKSPPQIDSHYSRAADAHSHDHEQEQKEEPTQGPYEDDDGMVGD 192 SP+ TS++++ P+ID H + + H Q + E+P+ +DDDG + D Sbjct: 40 SPNTATSSIIQVDPRIDDHNNNIKINYDSSHNQIEAEQPSSNDNQDDDGRIHD 92 >At4g02810.1 68417.m00381 expressed protein Length = 271 Score = 29.9 bits (64), Expect = 0.82 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 76 QIDSHYSRAADAHSHDHEQEQKEEPTQGPYEDDDGMVGDD 195 Q D+ + + E+E++EE + ED++G+VG++ Sbjct: 190 QYDAEEEEEEEEEEEEEEEEEEEEEEEEEEEDEEGIVGNN 229 >At2g32010.1 68415.m03911 endonuclease/exonuclease/phosphatase family protein similar to inositol polyphosphate 5-phosphatase I (GI:10444261) and II (GI:10444263) [Arabidopsis thaliana]; contains Pfam profile PF03372: Endonuclease/Exonuclease/phosphatase family Length = 594 Score = 29.9 bits (64), Expect = 0.82 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +1 Query: 85 SHYSRAADAHSHDHEQEQKEEPTQGPYEDDDGMVGDDPAAYLSN 216 S YSR +D +S + + ++ DDD GD P+ +L++ Sbjct: 260 SDYSRPSDYYSRPSNYSRPSDVSRWGSSDDDNGPGDSPSTFLNS 303 >At1g03350.1 68414.m00314 BSD domain-containing protein contains Pfam profile PF03909: BSD domain Length = 470 Score = 29.9 bits (64), Expect = 0.82 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 70 PPQIDSHYSRAADAHSHDHEQEQKEEPTQGPYEDDDG 180 PP+ +S + HS +HE ++E P Q DD G Sbjct: 14 PPETESESD--SPKHSEEHEHPEQEHPEQSESNDDGG 48 >At5g66840.1 68418.m08427 SAP domain-containing protein contains Pfam domain PF02037: SAP domain Length = 551 Score = 28.7 bits (61), Expect = 1.9 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = +1 Query: 31 QSPHLKTSAMLKSPPQIDSHYSRAADAHSHDHEQEQKEEPTQGPY 165 Q+PH+ +++ + H+S +H + + ++ E TQGPY Sbjct: 469 QNPHVSSNSGYNLGVRDLEHFSHMMISHRREGDTYRQSEVTQGPY 513 >At3g56590.1 68416.m06293 hydroxyproline-rich glycoprotein family protein Length = 477 Score = 28.7 bits (61), Expect = 1.9 Identities = 14/43 (32%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +1 Query: 37 PHLKTSAMLKSP-PQIDSHYSRAADAHSHDHEQEQKEEPTQGP 162 PH ++ SP PQ ++H H H H E EP+ P Sbjct: 313 PHSPATSSTPSPSPQPETHQYPHHHPHHHHHHHELAPEPSLSP 355 >At1g55080.1 68414.m06291 expressed protein Length = 244 Score = 28.7 bits (61), Expect = 1.9 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +1 Query: 28 LQSPHLKTSAMLKSPPQIDSHYSRAADAHSHDHEQEQKEEPTQGPYE 168 LQSP L+ ++ PPQ ++ + H+ +Q+ + P Q P + Sbjct: 100 LQSPPLQPQSLQSPPPQQTMVHTPQSMMHTPQQQQQLVQTPVQTPQQ 146 >At4g37270.1 68417.m05275 cadmium/zinc-transporting ATPase, putative (HMA1) contains InterPro accession IPR001757: ATPase, E1-E2 type; identical to Potential cadmium/zinc-transporting ATPase HMA1 (EC 3.6.3.3) (EC 3.6.3.5) (Swiss-Prot:Q9M3H5) [Arabidopsis thaliana]; identical to cDNA putative transcription factor (MYB73) mRNA, partial cds GI:3941503 Length = 819 Score = 28.3 bits (60), Expect = 2.5 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 28 LQSPHLKTSAMLKSPPQIDSHYSRAADAHSHDHEQEQKEE 147 L+ L+ SA L PP+ S RA + H HDH + +++ Sbjct: 41 LRQKPLRISASLNLPPR--SIRLRAVEDHHHDHHHDDEQD 78 >At3g17170.1 68416.m02190 ribosomal protein S6 family protein (RFC3) annotation temporarily based on supporting cDNA gi|15620809|dbj|AB057424.1|; contains TIGRfam TIGR00166 and Pfam PF01250 profiles ribosomal protein S6. Length = 314 Score = 28.3 bits (60), Expect = 2.5 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +1 Query: 70 PPQIDSHYSRAADAHSHDHEQEQ-KEEPTQGPYEDDD 177 PP + H RA D + D E+E+ +E+ +G ED++ Sbjct: 220 PPPPEFHSVRAGDEYYDDDEEEEIEEDEDEGEGEDEE 256 >At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 383 Score = 27.9 bits (59), Expect = 3.3 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +1 Query: 79 IDSHYSRAADAHSHDHEQEQKEEPTQ 156 +D++Y H+H+H+Q+ + PTQ Sbjct: 1 MDNNYQNYHHHHNHNHQQQWRPAPTQ 26 >At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 661 Score = 27.9 bits (59), Expect = 3.3 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +1 Query: 79 IDSHYSRAADAHSHDHEQEQKEEPTQ 156 +D++Y H+H+H+Q+ + PTQ Sbjct: 1 MDNNYQNYHHHHNHNHQQQWRPAPTQ 26 >At4g27310.1 68417.m03918 zinc finger (B-box type) family protein zinc-finger protein S3574, Oryza sativa, PIR3:JE0113 Length = 223 Score = 27.1 bits (57), Expect = 5.8 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +1 Query: 106 DAHSHDHEQEQKEEPTQGPYED-DDGMVGDDPAA 204 DA S+D ++E+ E+ ED DD GDD A Sbjct: 116 DAESYDDDEEEDEDEEYSDDEDEDDDEDGDDEEA 149 >At3g01260.1 68416.m00032 aldose 1-epimerase family protein similar to non-cell-autonomous protein pathway2, plasmodesmal receptor [Nicotiana tabacum] GI:15824567; contains Pfam profile PF01263: Aldose 1-epimerase Length = 378 Score = 27.1 bits (57), Expect = 5.8 Identities = 10/44 (22%), Positives = 22/44 (50%) Frame = +1 Query: 46 KTSAMLKSPPQIDSHYSRAADAHSHDHEQEQKEEPTQGPYEDDD 177 K++ + K + H A+ + HD + +++ G ++DDD Sbjct: 13 KSTDLKKFKGGVTDHSISKANDNDHDDDDHDQDDDNDGDHDDDD 56 >At1g22610.1 68414.m02823 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1029 Score = 27.1 bits (57), Expect = 5.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 64 KSPPQIDSHYSRAADAHSHDHEQEQKEEPTQGP 162 + PP +D+ S+A +AH + ++E PT P Sbjct: 894 RHPPHMDARVSQADNAHPDELDEEFDTFPTSRP 926 >At5g60760.1 68418.m07623 2-phosphoglycerate kinase-related contains weak similarity to 2-phosphoglycerate kinase (GI:467751) [Methanothermus fervidus] Length = 738 Score = 26.6 bits (56), Expect = 7.6 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = +1 Query: 31 QSPHLKTSAMLKSPPQIDSHYSRAADAHSHDHEQEQKEEPTQGPYEDDD 177 QS H + PP+ D+ +S + HD E+ T+ E DD Sbjct: 585 QSVHGSDEEVEDDPPEPDTDFSDDDNKRDHDEVGSVDEQSTKSDEEYDD 633 >At3g25100.1 68416.m03135 cell division control protein-related contains weak similarity to cell division control protein 45 homolog (Suppressor of nda4 protein) (Swiss-Prot:O74113) [Schizosaccharomyces pombe] Length = 596 Score = 26.6 bits (56), Expect = 7.6 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 82 DSHYSRAADAHSHDHEQEQKEEPTQGPYEDDDG 180 +S R DA E+E+ EE + +DDDG Sbjct: 158 ESFQLRVEDAGEESDEEEEDEEEDEEDDDDDDG 190 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,104,854 Number of Sequences: 28952 Number of extensions: 132914 Number of successful extensions: 524 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 494 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 520 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 722638680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -