BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_G11 (458 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_03_0150 + 10810322-10810380,10810530-10810593,10810803-108110... 29 1.8 01_02_0063 - 10746968-10747783,10747995-10748222 29 2.4 08_02_0796 - 21300251-21300373,21300846-21301721 28 3.1 08_02_0158 - 13392323-13392545,13392618-13392739 28 3.1 07_03_0851 + 22012836-22014017,22016668-22016734,22016774-220168... 28 3.1 06_03_0714 - 23814826-23814997,23815080-23815164,23815680-238157... 28 4.2 02_03_0235 - 16702768-16702956,16703956-16704492,16705084-167052... 28 4.2 12_02_0819 + 23432681-23432998,23433118-23433348 27 5.5 04_04_0457 + 25359486-25359571,25360690-25360782,25361561-253616... 27 5.5 12_02_0326 + 17555731-17556387 27 7.3 02_04_0460 - 23118221-23118406,23118417-23118671,23118763-231188... 27 7.3 01_05_0289 + 20482472-20482603,20483175-20483345,20483501-204835... 27 7.3 12_02_1169 - 26655170-26655332,26655429-26655504,26655603-266557... 27 9.6 10_07_0195 + 13972656-13972970,13973518-13973848,13975312-139754... 27 9.6 09_04_0472 - 17895285-17896459,17897113-17897271,17897374-178977... 27 9.6 06_03_0845 + 25324209-25324443,25325267-25325313,25325420-253255... 27 9.6 02_05_1357 + 35899480-35899578,35900247-35900334,35900438-359005... 27 9.6 01_01_0443 - 3314002-3314565 27 9.6 >11_03_0150 + 10810322-10810380,10810530-10810593,10810803-10811047, 10811627-10811747,10811821-10811895,10811986-10812112, 10812194-10812939,10813065-10813195,10813547-10813636, 10814000-10814105 Length = 587 Score = 29.1 bits (62), Expect = 1.8 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -2 Query: 157 QLEDSERLRGPGHEYRDQNSRYQAESS 77 +LE SER R P YR Q+S+ Q SS Sbjct: 421 RLESSERQRPPSQSYRPQSSQGQRPSS 447 >01_02_0063 - 10746968-10747783,10747995-10748222 Length = 347 Score = 28.7 bits (61), Expect = 2.4 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -2 Query: 121 HEYRDQNSRYQAESSDSLLPSKRQPTPE 38 HEY D + + ++ SDSLL + P PE Sbjct: 303 HEYADNATLWDSDFSDSLLKLSQLPMPE 330 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 28.3 bits (60), Expect = 3.1 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 157 QLEDSERLRGPGHEYRDQNSRYQAESSDS 71 Q +++R+RGPGH + D + +S DS Sbjct: 145 QSPETDRVRGPGHHHDDDAAADDDDSEDS 173 >08_02_0158 - 13392323-13392545,13392618-13392739 Length = 114 Score = 28.3 bits (60), Expect = 3.1 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +3 Query: 309 TQRAAENYERSQSTTGNINTFSIPTRHPMYV-DQLTNF 419 T R+ +N S+S TG+ N F++ HP V D + ++ Sbjct: 30 TSRSTDNSMTSRSITGSNNPFALQIEHPPVVHDDIASY 67 >07_03_0851 + 22012836-22014017,22016668-22016734,22016774-22016868, 22017304-22017717 Length = 585 Score = 28.3 bits (60), Expect = 3.1 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 3/72 (4%) Frame = -2 Query: 217 GEYGGAFHPRFSLSAQISCNQLEDSERLRGPGHEYRDQNSRYQAESSDSLLPSK---RQP 47 G GG F +S+ + + E E++ H YR R E L S+ + Sbjct: 315 GSVGGTFDLHYSIWGKEGATRREQMEKIIPLDHGYR-YYIRGAMEKHLLLARSRGEGEED 373 Query: 46 TPELPDTSCWSV 11 TPE PD C+S+ Sbjct: 374 TPEEPDLECFSL 385 >06_03_0714 - 23814826-23814997,23815080-23815164,23815680-23815791, 23817203-23817304,23817375-23817447,23817918-23817997, 23818076-23818267,23818945-23819064,23819157-23819244, 23819319-23819353,23819447-23819518,23819860-23819931, 23820054-23821189,23822011-23822362 Length = 896 Score = 27.9 bits (59), Expect = 4.2 Identities = 14/53 (26%), Positives = 21/53 (39%) Frame = -2 Query: 163 CNQLEDSERLRGPGHEYRDQNSRYQAESSDSLLPSKRQPTPELPDTSCWSVSS 5 CN ++DS+ RG +N + + R P L C S+SS Sbjct: 421 CNSIQDSDLDRGGRKRSSSENGHAAQKRPQKISKPPRSPATSLKQLPCVSLSS 473 >02_03_0235 - 16702768-16702956,16703956-16704492,16705084-16705233, 16705310-16705625,16707005-16707286,16707895-16707971, 16708121-16708186,16708700-16709246,16709435-16709565, 16709642-16709746,16709859-16710039,16710123-16710185, 16711000-16711109,16711576-16711638,16711859-16712191 Length = 1049 Score = 27.9 bits (59), Expect = 4.2 Identities = 16/31 (51%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -3 Query: 129 DLVMNTEIKIVVIRQNHRIPFYH-PNGSQHQ 40 DL T++ IVV HRIP YH N SQ Q Sbjct: 827 DLSRKTDLVIVVHNLAHRIPQYHQSNTSQPQ 857 >12_02_0819 + 23432681-23432998,23433118-23433348 Length = 182 Score = 27.5 bits (58), Expect = 5.5 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = +1 Query: 28 YLVILVLAAVWMVEGNPMILPD--NDYFDLGIHDQVLG 135 Y V AA W V G +LP+ +FD G HDQ G Sbjct: 73 YSAFEVAAAAWEVAGGATLLPEAMQLWFDFG-HDQGFG 109 >04_04_0457 + 25359486-25359571,25360690-25360782,25361561-25361622, 25361758-25361816,25363624-25363733,25364795-25364829, 25365469-25365546,25365952-25366005,25366277-25366362, 25366468-25366571,25366986-25367054,25367135-25367250, 25367387-25367421,25367512-25367654,25367808-25367930, 25368463-25368556 Length = 448 Score = 27.5 bits (58), Expect = 5.5 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -2 Query: 388 WRVGMLNVFIFPVVL*LRS*FSAALCVRVR 299 W +G +NV IFPV L L S F LC +R Sbjct: 35 WSLGKINVLIFPVDLFLGSYF---LCFTIR 61 >12_02_0326 + 17555731-17556387 Length = 218 Score = 27.1 bits (57), Expect = 7.3 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 202 LHHILHGNDNKHEQDDNSSKPKHPAA 279 LH H +HE+DDN P +PA+ Sbjct: 72 LHLQPHHPKPEHEEDDNDHNPSNPAS 97 >02_04_0460 - 23118221-23118406,23118417-23118671,23118763-23118851, 23119527-23119605,23121317-23121484,23121760-23122137 Length = 384 Score = 27.1 bits (57), Expect = 7.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -2 Query: 115 YRDQNSRYQAESSDSLLPSKRQPTPELP 32 Y D+ SR+++ SSD L P P +LP Sbjct: 67 YLDELSRWESLSSDVLAPLPAAPAADLP 94 >01_05_0289 + 20482472-20482603,20483175-20483345,20483501-20483530, 20483640-20483847,20483952-20484033,20484128-20484236, 20484329-20484745 Length = 382 Score = 27.1 bits (57), Expect = 7.3 Identities = 16/58 (27%), Positives = 26/58 (44%) Frame = +1 Query: 19 NMRYLVILVLAAVWMVEGNPMILPDNDYFDLGIHDQVLGVFPNLLTDYMKFERSVRSV 192 N ++L + V+G +L ++ H V GV P L+ Y F SVR++ Sbjct: 69 NFKWLDGFTIQGTGTVDGQSTLLRSVSPANVSQHWYVSGVKPTLIRFYSSFNVSVRNI 126 >12_02_1169 - 26655170-26655332,26655429-26655504,26655603-26655715, 26655808-26655913,26656001-26656235,26656415-26656573, 26657279-26657377,26657472-26657568,26657650-26657768, 26657860-26658000,26658100-26658184,26658287-26658488, 26659274-26659379 Length = 566 Score = 26.6 bits (56), Expect = 9.6 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -2 Query: 184 SLSAQISCNQLEDSERLRGPGHEYRDQNSRYQAESSDSLLPSKRQPT 44 SL A +Q D E++RGP + + ES + L K+Q T Sbjct: 368 SLEASFRLSQEYDEEKVRGPPVDANHEQLSSVVESINDTLIEKKQDT 414 >10_07_0195 + 13972656-13972970,13973518-13973848,13975312-13975463, 13975573-13976280,13976424-13976615,13977264-13977425 Length = 619 Score = 26.6 bits (56), Expect = 9.6 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 73 SLLPSKRQPTPELPDTSCWSVSSC 2 S LP+ R P P++P TS +SC Sbjct: 586 SHLPAPRSPEPDIPTTSLTRRASC 609 >09_04_0472 - 17895285-17896459,17897113-17897271,17897374-17897794, 17898520-17898552,17898902-17899384 Length = 756 Score = 26.6 bits (56), Expect = 9.6 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 199 TLHHILHGNDNKHEQDDNSSKPKHPAAE 282 TL ++HGN N+H D + H +AE Sbjct: 513 TLFSLIHGNHNQHISLDTRLRIAHESAE 540 >06_03_0845 + 25324209-25324443,25325267-25325313,25325420-25325549, 25326105-25326205,25326625-25326933 Length = 273 Score = 26.6 bits (56), Expect = 9.6 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 253 SSKPKHPAAEIVRKGIEHGHKGLQKITSAVKAP 351 +SKPK P + G+EHG+ L T + K P Sbjct: 59 ASKPKPPLV-LPTTGVEHGYTELMMATYSEKGP 90 >02_05_1357 + 35899480-35899578,35900247-35900334,35900438-35900592, 35900652-35900715,35902910-35902974,35903061-35903126, 35903644-35903745 Length = 212 Score = 26.6 bits (56), Expect = 9.6 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 266 SILLQRSSERVSNTDTKGCRKLRAQSKHHW 355 S++ + S E VS K CR L S H W Sbjct: 86 SLISKASYENVSKKAIKSCRPLSLLSLHEW 115 >01_01_0443 - 3314002-3314565 Length = 187 Score = 26.6 bits (56), Expect = 9.6 Identities = 13/53 (24%), Positives = 22/53 (41%) Frame = -2 Query: 223 YHGEYGGAFHPRFSLSAQISCNQLEDSERLRGPGHEYRDQNSRYQAESSDSLL 65 + G+ A H R S + CN + G RD+ R+ E D+++ Sbjct: 118 FMGDPSKACHVRLQASPEFKCNNPTNINYSSIEGASLRDEGKRWTGEGYDNVM 170 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,257,269 Number of Sequences: 37544 Number of extensions: 274207 Number of successful extensions: 922 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 893 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 921 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 907440304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -