BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_G11 (458 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced ... 25 1.7 AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal ... 24 2.2 AY146755-1|AAO12070.1| 320|Anopheles gambiae odorant-binding pr... 24 2.9 AY146754-1|AAO12069.1| 334|Anopheles gambiae odorant-binding pr... 24 2.9 L07880-1|AAA29358.1| 218|Anopheles gambiae glutathione S-transf... 23 3.9 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 23 5.1 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 23 5.1 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 23 5.1 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 23 5.1 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 23 5.1 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 23 5.1 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 23 5.1 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 23 5.1 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 23 5.1 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 23 5.1 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 23 5.1 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 23 5.1 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 23 5.1 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 23 5.1 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 23 5.1 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 23 5.1 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 23 5.1 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 23 5.1 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 23 5.1 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 23 5.1 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 23 5.1 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 23 5.1 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 23 5.1 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 23 5.1 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 23 5.1 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 23 5.1 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 23 5.1 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 23 5.1 EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein A... 23 6.8 AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CY... 23 6.8 AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CY... 22 9.0 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 22 9.0 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 22 9.0 >AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced homeotic protein protein. Length = 372 Score = 24.6 bits (51), Expect = 1.7 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = -2 Query: 130 GPGHEYRDQNSRYQAESSDSLLPSKRQPTPELPDTSC 20 G GH+ D Q + LL ++QP L SC Sbjct: 90 GGGHQSTDMVDYTQLQPQKFLLSQQQQPQSALTSQSC 126 >AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal carrier protein AP-1 protein. Length = 171 Score = 24.2 bits (50), Expect = 2.2 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = +3 Query: 339 SQSTTGNINTF---SIPTRHPMYVDQLTNFLQPFG 434 + S TG+I+++ I H +DQL+N PFG Sbjct: 136 NHSGTGDIHSYLYEQIEDLHKAILDQLSNAGNPFG 170 >AY146755-1|AAO12070.1| 320|Anopheles gambiae odorant-binding protein AgamOBP32 protein. Length = 320 Score = 23.8 bits (49), Expect = 2.9 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 Query: 66 YHPNGSQHQNYQIPHVGVFPRA 1 YH SQ N+ PHV V RA Sbjct: 110 YHCLNSQRLNHPSPHVDVCERA 131 >AY146754-1|AAO12069.1| 334|Anopheles gambiae odorant-binding protein AgamOBP33 protein. Length = 334 Score = 23.8 bits (49), Expect = 2.9 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 Query: 66 YHPNGSQHQNYQIPHVGVFPRA 1 YH SQ N+ PHV V RA Sbjct: 110 YHCLNSQRLNHPSPHVDVCERA 131 >L07880-1|AAA29358.1| 218|Anopheles gambiae glutathione S-transferase protein. Length = 218 Score = 23.4 bits (48), Expect = 3.9 Identities = 10/28 (35%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 145 NLLTDYMKFERSVRSVGETLHHIL-HGN 225 N++ DY + +V+++GE L +L +GN Sbjct: 14 NIMPDYKVYYFNVKALGEPLRFLLSYGN 41 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 99 YADWCFACMK-AANSFKKLIDTL 120 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 99 YADWCFACMK-AANSFKKLIDTL 120 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 99 YADWCFACMK-AANSFKKLIDTL 120 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 99 YADWCFACMK-AANSFKKLIDTL 120 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 99 YADWCFACMK-AANSFKKLIDTL 120 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 99 YADWCFACMK-AANSFKKLIDTL 120 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 84 YADWCFACMK-AANSFKKLIDTL 105 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 84 YADWCFACMK-AANSFKKLIDTL 105 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 86 YADWCFACMK-AANSFKKLIDTL 107 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 86 YADWCFACMK-AANSFKKLIDTL 107 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 89 YADWCFACMK-AANSFKKLIDTL 110 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 89 YADWCFACMK-AANSFKKLIDTL 110 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 99 YADWCFACMK-AANSFKKLIDTL 120 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 99 YADWCFACMK-AANSFKKLIDTL 120 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 99 YADWCFACMK-AANSFKKLIDTL 120 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 99 YADWCFACMK-AANSFKKLIDTL 120 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 99 YADWCFACMK-AANSFKKLIDTL 120 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 99 YADWCFACMK-AANSFKKLIDTL 120 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 101 YADWCFACMK-AANSFKKLIDTL 122 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 101 YADWCFACMK-AANSFKKLIDTL 122 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 83 YADWCFACMK-AANSFKKLIDTL 104 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 83 YADWCFACMK-AANSFKKLIDTL 104 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 360 YSQWCFDCARNFLQPFVSVFDTL 292 Y+ WCF C + F + DTL Sbjct: 98 YADWCFACMK-AANSFKKLIDTL 119 >EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein AA protein. Length = 62 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 84 NHRIPFYHPNGSQHQNYQIPH 22 + R PF+H + Q + ++PH Sbjct: 21 SQRSPFHHHHQQQQNHQRMPH 41 >AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CYP4H24 protein. Length = 193 Score = 22.6 bits (46), Expect = 6.8 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = +1 Query: 55 VWMVEGNPMILPDNDYFD 108 ++++ NP++ PD + FD Sbjct: 95 IYVIHRNPVVYPDPERFD 112 >AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CYP4H19 protein. Length = 151 Score = 22.2 bits (45), Expect = 9.0 Identities = 6/18 (33%), Positives = 12/18 (66%) Frame = +1 Query: 55 VWMVEGNPMILPDNDYFD 108 ++++ NP + PD + FD Sbjct: 104 IYVIHRNPAVFPDPERFD 121 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 22.2 bits (45), Expect = 9.0 Identities = 12/47 (25%), Positives = 20/47 (42%) Frame = -2 Query: 163 CNQLEDSERLRGPGHEYRDQNSRYQAESSDSLLPSKRQPTPELPDTS 23 C + D ++ + R+Q ++YQ ES P P +TS Sbjct: 755 CKIMYDDRKMFAKFEKEREQETKYQMESPLYKSPISNFKVPAEMETS 801 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 22.2 bits (45), Expect = 9.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 109 DQNSRYQAESSDSLLPSKRQPTPELP 32 D+ S Y A ++ +R PTP P Sbjct: 1106 DRTSLYSARNTSEEQRGRRHPTPSPP 1131 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 515,837 Number of Sequences: 2352 Number of extensions: 10635 Number of successful extensions: 75 Number of sequences better than 10.0: 62 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39544623 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -