BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_G11 (458 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 24 0.91 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 24 0.91 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 24 0.91 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 24 0.91 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 24 0.91 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 24 0.91 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 24 0.91 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 24 0.91 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 24 0.91 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 24 0.91 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 24 0.91 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 23 1.2 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 23 1.2 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 23 1.2 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 23 1.2 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 23 1.2 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 23 1.2 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 23 1.2 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 23 1.6 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 23 1.6 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 23 1.6 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 23 1.6 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 23 1.6 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 23 1.6 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 23 1.6 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 23 1.6 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 23 1.6 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 23 1.6 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 23 1.6 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 23 1.6 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 23 1.6 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 23 1.6 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 23 1.6 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 23 1.6 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 23 1.6 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 23 1.6 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 23 1.6 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 23 2.1 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 23 2.1 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 23 2.1 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 2.1 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 2.1 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 22 2.8 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 2.8 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 2.8 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 22 2.8 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 2.8 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 2.8 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 22 2.8 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 2.8 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 2.8 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 2.8 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 2.8 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 22 2.8 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 3.7 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 3.7 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 22 3.7 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 22 3.7 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 22 3.7 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 22 3.7 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 22 3.7 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 3.7 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 22 3.7 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 3.7 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 3.7 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 3.7 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 3.7 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 3.7 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 3.7 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 22 3.7 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 22 3.7 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 22 3.7 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 22 3.7 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 22 3.7 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 22 3.7 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 22 3.7 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 3.7 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 3.7 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 3.7 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 3.7 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 3.7 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 3.7 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 3.7 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 3.7 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 3.7 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 3.7 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 3.7 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 3.7 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 3.7 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 3.7 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 3.7 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 21 4.8 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 21 4.8 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 21 4.8 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 21 4.8 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 21 4.8 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 21 4.8 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 4.8 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 4.8 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 4.8 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 4.8 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 4.8 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 4.8 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 4.8 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 4.8 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 4.8 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 21 4.8 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 21 4.8 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 6.4 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 6.4 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 21 8.5 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 21 8.5 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 8.5 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 21 8.5 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 8.5 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 8.5 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 23.8 bits (49), Expect = 0.91 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = -1 Query: 386 ACRYAKRIYIPSGALTALVIFCSPLCPCSI 297 +C+Y +++Y+ GAL + + C C + Sbjct: 18 SCKYCEKVYVSLGALKMHIRTHTLPCKCHL 47 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.8 bits (49), Expect = 0.91 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + YR + +R Sbjct: 231 YSRERSCSRDRNREYRKKDRR 251 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 0.91 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + YR + +R Sbjct: 231 YSRERSCSRDRNREYRKKDRR 251 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 0.91 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + YR + +R Sbjct: 231 YSRERSCSRDRNREYRKKDRR 251 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 0.91 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + YR + +R Sbjct: 231 YSRERSCSRDRNREYRKKDRR 251 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 0.91 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + YR + +R Sbjct: 231 YSRERSCSRDRNREYRKKDRR 251 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.8 bits (49), Expect = 0.91 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + YR + +R Sbjct: 220 YSRERSCSRDRNREYRKKDRR 240 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 23.8 bits (49), Expect = 0.91 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + YR + +R Sbjct: 231 YSRERSCSRDRNREYRKKDRR 251 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 23.8 bits (49), Expect = 0.91 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + YR + +R Sbjct: 236 YSRERSCSRDRNREYRKKDRR 256 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.8 bits (49), Expect = 0.91 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + YR + +R Sbjct: 231 YSRERSCSRDRNREYRKKDRR 251 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.8 bits (49), Expect = 0.91 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + YR + +R Sbjct: 231 YSRERSCSRDRNREYREKDRR 251 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYREKNRR 18 Score = 20.6 bits (41), Expect = 8.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 133 RGPGHEYRDQNSRYQ 89 R EYR++N RY+ Sbjct: 6 RDRNREYREKNRRYE 20 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYREKNRR 18 Score = 20.6 bits (41), Expect = 8.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 133 RGPGHEYRDQNSRYQ 89 R EYR++N RY+ Sbjct: 6 RDRNREYREKNRRYE 20 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYREKNRR 18 Score = 20.6 bits (41), Expect = 8.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 133 RGPGHEYRDQNSRYQ 89 R EYR++N RY+ Sbjct: 6 RDRNREYREKNRRYE 20 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYREKNRR 18 Score = 20.6 bits (41), Expect = 8.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 133 RGPGHEYRDQNSRYQ 89 R EYR++N RY+ Sbjct: 6 RDRNREYREKNRRYE 20 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYREKNRR 18 Score = 20.6 bits (41), Expect = 8.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 133 RGPGHEYRDQNSRYQ 89 R EYR++N RY+ Sbjct: 6 RDRNREYREKNRRYE 20 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYREKNRR 18 Score = 20.6 bits (41), Expect = 8.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 133 RGPGHEYRDQNSRYQ 89 R EYR++N RY+ Sbjct: 6 RDRNREYREKNRRYE 20 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYREKNRR 18 Score = 20.6 bits (41), Expect = 8.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 133 RGPGHEYRDQNSRYQ 89 R EYR++N RY+ Sbjct: 6 RDRNREYREKNRRYE 20 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYRKKDRR 18 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYRKKDRR 18 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYRKKDRR 18 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYRKKDRR 18 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYRKKDRR 18 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYRKKDRR 18 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQRAAENYERSQ 344 + SC RDR + YR + ++ + Y + Sbjct: 1 ERSCSRDRNREYRKKDRQYEKLYNEKE 27 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQRAAENYERSQ 344 + SC RDR + YR + ++ + Y + Sbjct: 1 ERSCSRDRNREYRKKDRQYEKLYNEKE 27 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQRAAENYERSQ 344 + SC RDR + YR + ++ + Y + Sbjct: 1 ERSCSRDRNREYRKKDRQYEKLYNEKE 27 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQRAAENYERSQ 344 + SC RDR + YR + ++ + Y + Sbjct: 1 ERSCSRDRNREYRKKDRQYEKLYNEKE 27 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYREKDRR 18 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYREKDRR 18 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYREKDRR 18 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYREKDRR 18 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYRKKDRR 18 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYRKKDRR 18 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYRKKDRR 18 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYRKKDRR 18 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + +R Sbjct: 1 ERSCSRDRNREYRKKDRR 18 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.6 bits (46), Expect = 2.1 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + Y+ + +R Sbjct: 220 YSRERSCSRDRNREYKEKDRR 240 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.6 bits (46), Expect = 2.1 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + Y+ + +R Sbjct: 231 YSRERSCSRDRNREYKEKDRR 251 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 22.6 bits (46), Expect = 2.1 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + Y+ + +R Sbjct: 231 YSRERSCSRDRNREYKEKDRR 251 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.6 bits (46), Expect = 2.1 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + Y+ + +R Sbjct: 231 YSRERSCSRDRNREYKKKDRR 251 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.6 bits (46), Expect = 2.1 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + Y+ + +R Sbjct: 231 YSRERSCSRDRNREYKEKDRR 251 Score = 22.2 bits (45), Expect = 2.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 145 SERLRGPGHEYRDQNSRYQAESSDS 71 S LR H+++ +SRY E S S Sbjct: 214 SNSLRSRTHDFQHTSSRYSRERSCS 238 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 22.2 bits (45), Expect = 2.8 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQRAAENYERSQ 344 + SC +DR + Y+ + +R + Y + Sbjct: 1 ERSCSKDRNREYKEKDRRYEKLYNEKE 27 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 2.8 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + YR + ++ Sbjct: 220 YSRERSCSRDRNREYRKKDRQ 240 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 2.8 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + YR + ++ Sbjct: 231 YSRERSCSRDRNREYRKKDRQ 251 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 2.8 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + YR + ++ Sbjct: 220 YSRERSCSRDRNREYRKKDRQ 240 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 2.8 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + YR + ++ Sbjct: 231 YSRERSCSRDRNREYRKKDRQ 251 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 2.8 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + YR + ++ Sbjct: 231 YSRERSCSRDRNREYRKKDRQ 251 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 2.8 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + YR + ++ Sbjct: 220 YSRERSCSRDRNREYRKKDRQ 240 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 2.8 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + YR + ++ Sbjct: 231 YSRERSCSRDRNREYRKKDRQ 251 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 2.8 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + YR + ++ Sbjct: 231 YSRERSCSRDRNREYRKKDRQ 251 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 2.8 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + YR + ++ Sbjct: 231 YSRERSCSRDRNREYRKKDRQ 251 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 2.8 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 255 FETQASCCRDRQKGYRTRTQR 317 + + SC RDR + YR + ++ Sbjct: 220 YSRERSCSRDRNREYRKKDRQ 240 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 22.2 bits (45), Expect = 2.8 Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +1 Query: 61 MVEGNPMILPDND--YFDLGIHDQVLGVFPNLLTDY 162 M+ P P+ D Y D G +++ FP+ ++DY Sbjct: 363 MMRRTPYSTPEYDDTYMDSGYTNEIDFSFPDSVSDY 398 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRNREYKEKDRR 18 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRSREYKKKDRR 18 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRSREYKKKDRR 18 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRSREYKKKDRR 18 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRSREYKKKDRR 18 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRSREYKKKDRR 18 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 EKSCSRDRSREYKKKDRR 18 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 1 ERSCSRDRSREYKKKDRR 18 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 250 ERSCSRDRSREYKKKDRR 267 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 250 ERSCSRDRSREYKKKDRR 267 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 250 ERSCSRDRSREYKKKDRR 267 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 250 ERSCSRDRSREYKKKDRR 267 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 250 ERSCSRDRSREYKKKDRR 267 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 250 ERSCSRDRSREYKKKDRR 267 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + Y+ + +R Sbjct: 250 ERSCSRDRSREYKKKDRR 267 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.8 bits (44), Expect = 3.7 Identities = 15/57 (26%), Positives = 26/57 (45%) Frame = +1 Query: 133 GVFPNLLTDYMKFERSVRSVGETLHHILHGNDNKHEQDDNSSKPKHPAAEIVRKGIE 303 GVF N + FE+++ + L+++ G KH + S P A + + IE Sbjct: 38 GVFSNNKSKKY-FEQTLNELNFNLNYVNKGVTYKHTIIEMDSNPIKTALSVCKSLIE 93 Score = 20.6 bits (41), Expect = 8.5 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +3 Query: 372 SIPTRHPMYVDQLTNFLQPFGI*LLVLI 455 +I + P L +FLQPF L +L+ Sbjct: 545 TILEKKPSRSSTLVSFLQPFSNTLWILV 572 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + ++ Sbjct: 1 ERSCSRDRNREYRKKDRQ 18 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + ++ Sbjct: 1 ERSCSRDRNREYRKKDRQ 18 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + ++ Sbjct: 1 ERSCSRDRNREYRKKDRQ 18 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + ++ Sbjct: 1 ERSCSRDRNREYRKKDRQ 18 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + ++ Sbjct: 1 ERSCSRDRNREYRKKDRQ 18 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + ++ Sbjct: 1 ERSCSRDRNREYRKKDRQ 18 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + ++ Sbjct: 1 ERSCSRDRNREYRKKDRQ 18 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + ++ Sbjct: 1 ERSCSRDRNREYRKKDRQ 18 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + ++ Sbjct: 1 ERSCSRDRNREYRKKDRQ 18 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + ++ Sbjct: 1 ERSCSRDRNREYRKKDRQ 18 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + ++ Sbjct: 1 ERSCSRDRNREYRKKDRQ 18 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + ++ Sbjct: 1 ERSCSRDRNREYRKKDRQ 18 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + ++ Sbjct: 1 ERSCSRDRNREYRKKDRQ 18 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + ++ Sbjct: 1 ERSCSRDRNREYRKKDRQ 18 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 264 QASCCRDRQKGYRTRTQR 317 + SC RDR + YR + ++ Sbjct: 1 ERSCSRDRNREYRKKDRQ 18 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.4 bits (43), Expect = 4.8 Identities = 5/8 (62%), Positives = 5/8 (62%) Frame = +2 Query: 41 WCWLPFGW 64 W W P GW Sbjct: 176 WIWTPHGW 183 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.4 bits (43), Expect = 4.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 295 GIEHGHKGLQKITSAVKAP 351 G+EH H+ Q +AV+ P Sbjct: 17 GVEHPHQHQQHYGAAVQVP 35 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.0 bits (42), Expect = 6.4 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -2 Query: 454 IRTSSYIPKGCRKLV 410 +RT+S IP+G + LV Sbjct: 752 VRTASQIPQGFKDLV 766 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.0 bits (42), Expect = 6.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 160 YMKFERSVRSVGETLHHILH 219 Y K +V +GET+ +LH Sbjct: 442 YTKDSYTVAGMGETIEDLLH 461 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.6 bits (41), Expect = 8.5 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 264 QASCCRDRQKGYR 302 + SC RDR + YR Sbjct: 1 ERSCSRDRNREYR 13 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.6 bits (41), Expect = 8.5 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 264 QASCCRDRQKGYR 302 + SC RDR + YR Sbjct: 1 ERSCSRDRNREYR 13 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 20.6 bits (41), Expect = 8.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -2 Query: 145 SERLRGPGHEYRDQNSRYQAE 83 S LR H+++ +SRY E Sbjct: 214 SNSLRNRTHDFQHTSSRYSRE 234 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 20.6 bits (41), Expect = 8.5 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +2 Query: 44 CWLPFGW*KGIR*FC 88 CWLPF +R FC Sbjct: 21 CWLPFFTMYLVRAFC 35 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 20.6 bits (41), Expect = 8.5 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +2 Query: 44 CWLPFGW*KGIR*FC 88 CWLPF +R FC Sbjct: 469 CWLPFFTMYLVRAFC 483 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 20.6 bits (41), Expect = 8.5 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = +1 Query: 202 LHHILHGNDN 231 L+H+L GN+N Sbjct: 621 LYHVLRGNEN 630 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,304 Number of Sequences: 438 Number of extensions: 3300 Number of successful extensions: 125 Number of sequences better than 10.0: 116 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12189771 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -