BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_G10 (475 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137... 88 4e-18 05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32... 87 5e-18 01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782... 87 5e-18 12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323... 87 7e-18 03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731... 87 7e-18 10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910... 84 5e-17 01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054... 84 5e-17 05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585... 84 6e-17 11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306... 72 3e-13 03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324... 56 1e-08 12_02_1282 + 27528159-27529148,27529549-27529614 50 1e-06 08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207... 47 7e-06 02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980... 41 6e-04 08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160... 36 0.013 01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931... 36 0.017 04_04_1515 + 34117383-34117732,34117833-34117918,34118227-341182... 30 0.83 03_02_0209 + 6423962-6424159,6424360-6424569 30 0.83 04_01_0208 + 2596110-2596928 29 1.4 01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104,238... 27 5.8 >03_06_0585 - 34912159-34912224,34912634-34913247,34913350-34913734, 34913824-34913883 Length = 374 Score = 87.8 bits (208), Expect = 4e-18 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +1 Query: 10 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 129 KYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 335 KYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 374 >05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-324777 Length = 377 Score = 87.4 bits (207), Expect = 5e-18 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +1 Query: 10 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 129 KYSVWIGGSILASLSTFQQMWISK EYDESGP+IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKDEYDESGPAIVHRKCF 377 >01_07_0285 - 42476767-42476832,42476990-42477603,42477821-42478214, 42478301-42478360 Length = 377 Score = 87.4 bits (207), Expect = 5e-18 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +1 Query: 10 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 129 KYSVWIGGSILASLSTFQQMWISK EYDESGP+IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISKDEYDESGPAIVHRKCF 377 >12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847, 3233000-3233059 Length = 380 Score = 87.0 bits (206), Expect = 7e-18 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +1 Query: 10 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 129 KYSVWIGGSILASLSTFQQMWISK EYDESGP+IVHRKCF Sbjct: 341 KYSVWIGGSILASLSTFQQMWISKAEYDESGPAIVHRKCF 380 >03_05_0926 + 28871800-28871859,28871943-28872336,28872586-28873199, 28873281-28873346 Length = 377 Score = 87.0 bits (206), Expect = 7e-18 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +1 Query: 10 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 129 KYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377 >10_08_0597 + 19089616-19089675,19089789-19090182,19090451-19091064, 19091160-19091225 Length = 377 Score = 84.2 bits (199), Expect = 5e-17 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +1 Query: 10 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 129 KYSVWIGGSILASLSTFQQMWIS+ EY+ESGP+IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQMWISRAEYEESGPAIVHRKCF 377 >01_06_1455 + 37504175-37504231,37504357-37504750,37504865-37505478, 37506021-37506086 Length = 376 Score = 84.2 bits (199), Expect = 5e-17 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = +1 Query: 10 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 129 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVH KCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKAEYDESGPGIVHMKCF 376 >05_04_0450 - 21356877-21356942,21357482-21358095,21358173-21358566, 21358648-21358704 Length = 376 Score = 83.8 bits (198), Expect = 6e-17 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = +1 Query: 10 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 129 KYSVWIGGSILASLSTFQQMWISK EYDESGP IVH KCF Sbjct: 337 KYSVWIGGSILASLSTFQQMWISKGEYDESGPGIVHMKCF 376 >11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930, 3060979-3061044 Length = 391 Score = 71.7 bits (168), Expect = 3e-13 Identities = 38/54 (70%), Positives = 39/54 (72%), Gaps = 14/54 (25%) Frame = +1 Query: 10 KYSVWIGGSILASLSTFQQ--------------MWISKQEYDESGPSIVHRKCF 129 KYSVWIGGSILASLSTFQQ MWISK EYDESGP+IVHRKCF Sbjct: 338 KYSVWIGGSILASLSTFQQVNLTPTLYEVARMQMWISKGEYDESGPAIVHRKCF 391 >03_06_0192 + 32230953-32231030,32231130-32231485,32232250-32232425, 32233857-32234038,32234260-32234443,32235192-32235259, 32235343-32235495 Length = 398 Score = 56.4 bits (130), Expect = 1e-08 Identities = 22/40 (55%), Positives = 31/40 (77%) Frame = +1 Query: 10 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 129 +YS W+GG+ILA + Q ++K +YDE+GPSIVH+KCF Sbjct: 359 RYSAWLGGAILAKVVFPQNQHVTKGDYDETGPSIVHKKCF 398 >12_02_1282 + 27528159-27529148,27529549-27529614 Length = 351 Score = 49.6 bits (113), Expect = 1e-06 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = +1 Query: 40 LASLSTFQQMWISKQEYDESGPSIVHRKCF 129 LA S +MWI+K EYDESGPSIVHRKCF Sbjct: 322 LAPSSMKIKMWIAKAEYDESGPSIVHRKCF 351 >08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698, 2079924-2080097,2080184-2080257,2080847-2080927, 2081306-2081366,2081437-2081486,2082278-2082332, 2082599-2082676,2082757-2082810,2083703-2083756, 2083846-2083906,2084229-2084280,2085118-2085184, 2085393-2085452,2085546-2085608,2085752-2085814, 2086337-2086401,2086620-2086688,2086742-2086847 Length = 503 Score = 47.2 bits (107), Expect = 7e-06 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = +1 Query: 10 KYSVWIGGSILASLSTFQQMWISKQE 87 ++SVWIGGSILASL +FQQMW SK + Sbjct: 444 RFSVWIGGSILASLGSFQQMWFSKAD 469 >02_04_0473 + 23197294-23197340,23197443-23197680,23197792-23198016, 23198616-23198762,23198827-23198961,23199415-23199507, 23199925-23200044,23200303-23200413,23200486-23200611, 23200731-23200829,23201024-23201104 Length = 473 Score = 40.7 bits (91), Expect = 6e-04 Identities = 17/34 (50%), Positives = 24/34 (70%) Frame = +1 Query: 10 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSI 111 +Y+VW GGS+LAS + F + +K EY+E G SI Sbjct: 429 RYAVWFGGSVLASTAEFYEACHTKAEYEEYGASI 462 >08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328, 1604403-1604513,1604989-1605108,1605665-1605757, 1606024-1606157,1606503-1606530,1606821-1607075, 1607167-1607401,1608147-1608193 Length = 440 Score = 36.3 bits (80), Expect = 0.013 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 13 YSVWIGGSILASLSTFQQMWISKQEYDESGPSI 111 Y+ W GGS+ AS F + +K+EY+E G SI Sbjct: 397 YAAWFGGSVAASNPEFYESCHTKEEYEEHGASI 429 >01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744, 9318837-9318921,9319005-9319068,9319139-9319340, 9319808-9320502 Length = 429 Score = 35.9 bits (79), Expect = 0.017 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +1 Query: 22 WIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 129 W GGS+LA F+ M I+K EY+E G R+ F Sbjct: 393 WRGGSLLAHRPDFESMCITKSEYEEMGSMRCRRRFF 428 >04_04_1515 + 34117383-34117732,34117833-34117918,34118227-34118297, 34118457-34118524,34118692-34118753,34119010-34119107, 34119545-34119626,34119935-34120077,34120233-34120381, 34120461-34120594,34120714-34120832,34120926-34121014, 34121398-34121515 Length = 522 Score = 30.3 bits (65), Expect = 0.83 Identities = 14/42 (33%), Positives = 26/42 (61%), Gaps = 5/42 (11%) Frame = +1 Query: 7 GKYSVWIGGSILASLSTFQQMW-ISKQEYDE----SGPSIVH 117 G S W G +++++STF + W I K+++ + +GPS V+ Sbjct: 441 GTDSAWFGAKMISNVSTFTEAWCIKKKQFRQKTRRNGPSFVN 482 >03_02_0209 + 6423962-6424159,6424360-6424569 Length = 135 Score = 30.3 bits (65), Expect = 0.83 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +2 Query: 92 TSPAPRLCTGSASKRC--AHRCLQQPAVRSISRPAAQLR 202 T+PAP L A +RC A R +PA R+ RP LR Sbjct: 32 TAPAPALPRAPARRRCQMARRRKARPAARARRRPVLDLR 70 >04_01_0208 + 2596110-2596928 Length = 272 Score = 29.5 bits (63), Expect = 1.4 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = -2 Query: 156 WRQRCAQRLEALPVHNRGAGLVIFLFRDPHLLEGREGGEDRSTD 25 WR+R +R PVH RG +R P E EGG +R+ D Sbjct: 177 WRRRWRRRRRDRPVHGRGG---TGGWRRPAAWEREEGGGERARD 217 >01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104, 2389338-2389390,2390496-2390968,2391090-2391432, 2391793-2391911,2392081-2392512,2392657-2392747, 2392833-2392942,2393681-2393875,2394581-2394622, 2395144-2395268,2395856-2395926,2396047-2396147 Length = 1042 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 22 WIGGSILASLSTFQQMWISKQEYDESGPSIVHRK 123 W G + A+ S F + S +Y E G ++ HRK Sbjct: 669 WRGAAAFAASSKFGRHTFSLADYREHGENLFHRK 702 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,170,783 Number of Sequences: 37544 Number of extensions: 185271 Number of successful extensions: 582 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 581 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 967140324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -