BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_G09 (421 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_59638| Best HMM Match : HNF-1_N (HMM E-Value=0) 28 2.7 SB_31695| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_14136| Best HMM Match : Exonuc_X-T (HMM E-Value=6e-25) 28 3.6 SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_50089| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_39703| Best HMM Match : PHD (HMM E-Value=9.3e-12) 27 8.3 SB_33703| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 >SB_52941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 772 Score = 28.7 bits (61), Expect = 2.1 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -3 Query: 170 LRNIINISKTHADNQNYGTEL 108 + IIN S +H DNQN GT++ Sbjct: 629 INTIINTSNSHFDNQNNGTDV 649 >SB_59638| Best HMM Match : HNF-1_N (HMM E-Value=0) Length = 808 Score = 28.3 bits (60), Expect = 2.7 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = -3 Query: 416 ELAHVILDSSSSAVGLVRAVRVSVRRIGTLTV*CRFASISPVRPCDMEQTAS 261 EL +LDS S LVR V R+ + + A+++ PC E T+S Sbjct: 11 ELIRALLDSGLSGDDLVRIVDTEFSRVQD-RITAKSATLTQAEPCTPEPTSS 61 >SB_31695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 28.3 bits (60), Expect = 2.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 17 RILHAIFYIHLQLLFYFKYFLIRHNGVRRD*VQCHNFDC 133 RIL+ Y +Q LF+F Y +G + D V CH C Sbjct: 100 RILYCGVYSRVQRLFFFNY----QSGAKGDVVNCHIILC 134 >SB_14136| Best HMM Match : Exonuc_X-T (HMM E-Value=6e-25) Length = 1597 Score = 27.9 bits (59), Expect = 3.6 Identities = 18/85 (21%), Positives = 34/85 (40%) Frame = +3 Query: 165 PQVNQAPVTEVCLGCICQAVSGCKQGTKCEGDACGLFHITWPYWADAGKPTLNGQSPDAP 344 P+V Q + E G + S C+ G + L + D P+LNG+ + P Sbjct: 73 PKVEQTSIIEQVFGAGVEQKSKCRCGKDATKPSVSLLY-------DLEYPSLNGKPTETP 125 Query: 345 DAYPNCANEPYCAATAVQNYVSQFG 419 ++ + C ++Q + + G Sbjct: 126 VSFESIIEATLCREQSMQAWCDKCG 150 >SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2162 Score = 27.5 bits (58), Expect = 4.8 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = +3 Query: 141 CLADVYDVPQVNQAPVTEVCLGCICQAVSGCKQGTKCE----GDAC 266 C+ +VP +++ TE GC +++GC C+ GD C Sbjct: 164 CMESGTNVPFTSESKPTEPTPGCPLDSIAGCPNRKACDAGFTGDYC 209 >SB_50089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 26.6 bits (56), Expect = 8.3 Identities = 12/48 (25%), Positives = 21/48 (43%) Frame = +3 Query: 276 HITWPYWADAGKPTLNGQSPDAPDAYPNCANEPYCAATAVQNYVSQFG 419 + TW +W+ G P ++ S A + P+ A QN ++ G Sbjct: 36 YATWFFWSSRGYPVVSLASQPASQSVSRATPRPHTAPKWRQNTITAQG 83 >SB_39703| Best HMM Match : PHD (HMM E-Value=9.3e-12) Length = 886 Score = 26.6 bits (56), Expect = 8.3 Identities = 12/40 (30%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 286 HVIWNKPQASPSHLVPCLQP-DTAWQMQPRHTSVTGAWFT 170 HV+W++ + PSHL ++ +T W++ + G W+T Sbjct: 371 HVLWDRIKPDPSHLSGVMKKIETFWRICIL-PEMLGRWYT 409 >SB_33703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 745 Score = 26.6 bits (56), Expect = 8.3 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +3 Query: 261 ACGLFHITWPYWADAGKPTLNGQSPDAPDAYPNC-ANEPYCAATAV 395 +C +F ++ P D K TLN A P+C A PY A A+ Sbjct: 300 SCCMFEVSRPSDEDNEKVTLNPVESIACQTTPSCIAVSPYIPAEAI 345 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,073,901 Number of Sequences: 59808 Number of extensions: 267340 Number of successful extensions: 672 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 672 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 789494848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -