BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_G09 (421 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY659931-1|AAT51799.1| 167|Anopheles gambiae lysozyme i-1 protein. 131 9e-33 EF492429-1|ABP35929.1| 155|Anopheles gambiae lysozyme i-2 protein. 69 9e-14 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 25 0.84 AY994093-1|AAX86006.1| 45|Anopheles gambiae metallothionein 1 ... 25 1.5 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 23 3.4 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 23 3.4 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 23 3.4 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 23 3.4 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 23 3.4 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 23 3.4 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 23 3.4 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 23 3.4 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 23 3.4 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 23 3.4 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 23 3.4 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 23 3.4 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 23 3.4 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 23 3.4 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 23 3.4 AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/n... 23 6.0 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 6.0 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 6.0 AF469165-1|AAL68692.1| 226|Anopheles gambiae amylase protein. 23 6.0 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 22 7.9 AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. 22 7.9 AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. 22 7.9 AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. 22 7.9 AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. 22 7.9 AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. 22 7.9 AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleo... 22 7.9 AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. 22 7.9 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 22 7.9 AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein p... 22 7.9 >AY659931-1|AAT51799.1| 167|Anopheles gambiae lysozyme i-1 protein. Length = 167 Score = 131 bits (317), Expect = 9e-33 Identities = 59/104 (56%), Positives = 72/104 (69%), Gaps = 5/104 (4%) Frame = +3 Query: 123 ILIVGVC--LADVYDV--PQVN-QAPVTEVCLGCICQAVSGCKQGTKCEGDACGLFHITW 287 ++ +GV LADV + PQ + PVT+VCL CIC+A SGC +C GD CG+F ITW Sbjct: 11 LIAIGVSSVLADVSHIAPPQQQLEDPVTDVCLSCICEASSGCDASLRCSGDVCGMFAITW 70 Query: 288 PYWADAGKPTLNGQSPDAPDAYPNCANEPYCAATAVQNYVSQFG 419 YWADAGKP G SPD+ +AY NCANEPYCAA VQ Y+ +FG Sbjct: 71 AYWADAGKPVQQGDSPDSQNAYANCANEPYCAARTVQGYMRKFG 114 >EF492429-1|ABP35929.1| 155|Anopheles gambiae lysozyme i-2 protein. Length = 155 Score = 68.5 bits (160), Expect = 9e-14 Identities = 29/74 (39%), Positives = 38/74 (51%) Frame = +3 Query: 198 CLGCICQAVSGCKQGTKCEGDACGLFHITWPYWADAGKPTLNGQSPDAPDAYPNCANEPY 377 C CIC A +GC T C CG F I+ YW DAG+ L P A+ +CAN+ Sbjct: 29 CFRCICDASTGCSTSTTCRQSYCGPFSISRAYWMDAGRLVLPADEPTRWGAFEDCANDYD 88 Query: 378 CAATAVQNYVSQFG 419 CA V Y+ ++G Sbjct: 89 CATGIVTQYMEKYG 102 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 25.4 bits (53), Expect = 0.84 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +3 Query: 291 YWADAGKPTLNGQSPDAPDAYPNCA-NEPYCAATAVQNYVSQ 413 + A AG + S P+ + A N PY ++T QNY+ Q Sbjct: 42 FGALAGSNASSAGSAAGPELFDMYARNYPYVSSTEEQNYIEQ 83 >AY994093-1|AAX86006.1| 45|Anopheles gambiae metallothionein 1 protein. Length = 45 Score = 24.6 bits (51), Expect = 1.5 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +3 Query: 198 CLGCICQAVSGCKQGTKCEGD 260 C G C+ SGC G C D Sbjct: 5 CCGNDCKCTSGCGSGQPCATD 25 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 23.4 bits (48), Expect = 3.4 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +3 Query: 204 GCICQAVSGCKQGTKCEG 257 G C +SG ++G C G Sbjct: 453 GIYCDVISGAREGETCTG 470 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 259 SPSHLVPCLQPDTAWQMQPR 200 +PSHLVP ++P +Q R Sbjct: 331 APSHLVPGIEPSPDKMLQAR 350 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 259 SPSHLVPCLQPDTAWQMQPR 200 +PSHLVP ++P +Q R Sbjct: 331 APSHLVPGIEPSPDKMLQAR 350 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 259 SPSHLVPCLQPDTAWQMQPR 200 +PSHLVP ++P +Q R Sbjct: 331 APSHLVPGIEPSPDKMLQAR 350 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 259 SPSHLVPCLQPDTAWQMQPR 200 +PSHLVP ++P +Q R Sbjct: 331 APSHLVPGIEPSPDKMLQAR 350 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 259 SPSHLVPCLQPDTAWQMQPR 200 +PSHLVP ++P +Q R Sbjct: 331 APSHLVPGIEPSPDKMLQAR 350 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 259 SPSHLVPCLQPDTAWQMQPR 200 +PSHLVP ++P +Q R Sbjct: 331 APSHLVPGIEPSPDKMLQAR 350 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 259 SPSHLVPCLQPDTAWQMQPR 200 +PSHLVP ++P +Q R Sbjct: 331 APSHLVPGIEPSPDKMLQAR 350 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 259 SPSHLVPCLQPDTAWQMQPR 200 +PSHLVP ++P +Q R Sbjct: 331 APSHLVPGIEPSPDKMLQAR 350 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 259 SPSHLVPCLQPDTAWQMQPR 200 +PSHLVP ++P +Q R Sbjct: 331 APSHLVPGIEPSPDKMLQAR 350 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 259 SPSHLVPCLQPDTAWQMQPR 200 +PSHLVP ++P +Q R Sbjct: 331 APSHLVPGIEPSPDKMLQAR 350 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 259 SPSHLVPCLQPDTAWQMQPR 200 +PSHLVP ++P +Q R Sbjct: 331 APSHLVPGIEPSPDKMLQAR 350 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 259 SPSHLVPCLQPDTAWQMQPR 200 +PSHLVP ++P +Q R Sbjct: 331 APSHLVPGIEPSPDKMLQAR 350 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 259 SPSHLVPCLQPDTAWQMQPR 200 +PSHLVP ++P +Q R Sbjct: 331 APSHLVPGIEPSPDKMLQAR 350 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 259 SPSHLVPCLQPDTAWQMQPR 200 +PSHLVP ++P +Q R Sbjct: 315 APSHLVPGIEPSPDKMLQAR 334 >AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 568 Score = 22.6 bits (46), Expect = 6.0 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = -3 Query: 341 RIGTLTV*CRFASISPVRPCDMEQTASVA 255 R+ ++++ CR+ S+ P D E+ VA Sbjct: 485 RVVSVSLRCRYCSVPHYEPLDPERVYRVA 513 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 22.6 bits (46), Expect = 6.0 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -2 Query: 207 NRDILPLPVLGLLEEHHKHQQDTRRQ 130 NR I+P P ++HH H ++Q Sbjct: 770 NRRIVPSPNQQQQQQHHHHHLQQQQQ 795 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 22.6 bits (46), Expect = 6.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 213 CQAVSGCKQGTKCEGDAC 266 CQ +G K+G +CE D C Sbjct: 656 CQECTGYKKGEQCE-DEC 672 >AF469165-1|AAL68692.1| 226|Anopheles gambiae amylase protein. Length = 226 Score = 22.6 bits (46), Expect = 6.0 Identities = 10/26 (38%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +3 Query: 186 VTEVCL--GCICQAVSGCKQGTKCEG 257 + + CL G C +SG + GT C G Sbjct: 171 IWKACLPPGEYCDIISGERDGTMCTG 196 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 22.2 bits (45), Expect = 7.9 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -1 Query: 223 TAWQMQPR-HTSVTGAWFT*GTS*TSARHTPT 131 T W QPR T+ T +T T+ T+ H PT Sbjct: 172 TTWSDQPRPPTTTTTTVWTDSTA-TTTTHAPT 202 >AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 22.2 bits (45), Expect = 7.9 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +3 Query: 39 ISIFNYYFILNIF*SVIMASAVIKF 113 + +F Y+F + F ++ SAV+ F Sbjct: 161 VGLFYYWFHIKYFFKIMKNSAVLSF 185 >AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 22.2 bits (45), Expect = 7.9 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +3 Query: 39 ISIFNYYFILNIF*SVIMASAVIKF 113 + +F Y+F + F ++ SAV+ F Sbjct: 161 VGLFYYWFHIKYFFKIMKNSAVLSF 185 >AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 22.2 bits (45), Expect = 7.9 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +3 Query: 39 ISIFNYYFILNIF*SVIMASAVIKF 113 + +F Y+F + F ++ SAV+ F Sbjct: 161 VGLFYYWFHIKYFFKIMKNSAVLSF 185 >AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 22.2 bits (45), Expect = 7.9 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +3 Query: 39 ISIFNYYFILNIF*SVIMASAVIKF 113 + +F Y+F + F ++ SAV+ F Sbjct: 161 VGLFYYWFHIKYFFKIMKNSAVLSF 185 >AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 22.2 bits (45), Expect = 7.9 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +3 Query: 39 ISIFNYYFILNIF*SVIMASAVIKF 113 + +F Y+F + F ++ SAV+ F Sbjct: 161 VGLFYYWFHIKYFFKIMKNSAVLSF 185 >AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleotidase protein. Length = 568 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -3 Query: 341 RIGTLTV*CRFASISPVRPCDMEQTASVA 255 R+ ++++ CR+ S+ P D E VA Sbjct: 485 RVVSVSLRCRYCSVPHYEPLDPEHVYRVA 513 >AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. Length = 115 Score = 22.2 bits (45), Expect = 7.9 Identities = 16/45 (35%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +2 Query: 11 RTRILHAIFYIHLQLL-FYFKYFLIRHNGVRRD*VQCHNFDCRRV 142 R +L A+ + L LL Y V RD V C + DC RV Sbjct: 4 RVELLLAMVLLPLLLLESVVPYAAAEKVWVDRDKVYCGHLDCTRV 48 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 22.2 bits (45), Expect = 7.9 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +3 Query: 39 ISIFNYYFILNIF*SVIMASAVIKF 113 + +F Y+F + F ++ SAV+ F Sbjct: 388 VGLFYYWFHIKYFFKIMKNSAVLSF 412 >AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein protein. Length = 429 Score = 22.2 bits (45), Expect = 7.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 238 CLQPDTAWQMQPRHT 194 CLQP+ Q Q +HT Sbjct: 178 CLQPEQQHQRQQQHT 192 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 449,637 Number of Sequences: 2352 Number of extensions: 9690 Number of successful extensions: 43 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34632603 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -