BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_G08 (432 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_26764| Best HMM Match : ANF_receptor (HMM E-Value=0.001) 29 2.2 >SB_21430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 815 Score = 29.1 bits (62), Expect = 1.6 Identities = 18/77 (23%), Positives = 33/77 (42%), Gaps = 3/77 (3%) Frame = +3 Query: 144 IQLYSYYIESATLSRAD---LHHRYLDRIINLIRKLLKKTKYPNTKSIYNKVFPI*KNNN 314 I+ + Y +ES L R+ L + D I+ L + KY S Y + + + Sbjct: 183 IKKHFYILESIALVRSFTVCLELDFQDLILQLFKLFFSVVKYSQNPSAYRIASNLVEKTS 242 Query: 315 MQASPFVSVSFRALFTI 365 PF+ + F ++ T+ Sbjct: 243 SSIEPFIQMFFNSVLTL 259 >SB_26764| Best HMM Match : ANF_receptor (HMM E-Value=0.001) Length = 342 Score = 28.7 bits (61), Expect = 2.2 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +2 Query: 101 NIELINSIDTINKQDTIIFVLHRICYAITGRLTSQ 205 N +L+N + I + +T++ VLH C+A +L Q Sbjct: 202 NTDLLNKLGEIKRSETVVIVLH--CFAEEAKLILQ 234 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,133,006 Number of Sequences: 59808 Number of extensions: 161058 Number of successful extensions: 312 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 254 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 312 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 822495283 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -