BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_G08 (432 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY118991-1|AAM50851.1| 504|Drosophila melanogaster LP02712p pro... 28 6.2 AE014298-360|AAF45750.3| 504|Drosophila melanogaster CG18031-PA... 28 6.2 >AY118991-1|AAM50851.1| 504|Drosophila melanogaster LP02712p protein. Length = 504 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = -2 Query: 347 KGYRHKRRSLHIVIFLNR--KYFVIYRLCVWIFRFF 246 K +R L I +FL R + F++Y+L +W++R + Sbjct: 464 KTLERSKRILRIKVFLYRLLRLFLLYKLILWLWRSY 499 >AE014298-360|AAF45750.3| 504|Drosophila melanogaster CG18031-PA protein. Length = 504 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = -2 Query: 347 KGYRHKRRSLHIVIFLNR--KYFVIYRLCVWIFRFF 246 K +R L I +FL R + F++Y+L +W++R + Sbjct: 464 KTLERSKRILRIKVFLYRLLRLFLLYKLILWLWRSY 499 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,632,616 Number of Sequences: 53049 Number of extensions: 221839 Number of successful extensions: 530 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 530 length of database: 24,988,368 effective HSP length: 78 effective length of database: 20,850,546 effective search space used: 1355285490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -