BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_G07 (461 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0604 + 30536172-30537143 28 4.2 09_02_0587 - 10948888-10949124,10949281-10949393,10949830-109502... 27 5.6 08_01_0433 + 3794440-3794948,3795696-3796707 27 5.6 04_04_0418 + 25077748-25078101,25079413-25079538,25080683-250815... 27 5.6 01_06_1086 - 34421837-34422311,34422426-34422612,34423162-344232... 27 5.6 09_03_0005 + 11411828-11411894,11412122-11412677,11413424-11413433 27 7.3 09_02_0592 - 11006346-11006758,11012943-11013036 27 7.3 03_06_0327 - 33158131-33158315,33158586-33158639,33159149-331591... 27 7.3 08_01_0434 + 3809681-3810016,3810039-3811100 27 9.7 01_06_1089 - 34451982-34452670,34452755-34452814,34453287-344533... 27 9.7 01_06_1088 - 34439311-34439987,34440080-34440136,34442790-344429... 27 9.7 >01_06_0604 + 30536172-30537143 Length = 323 Score = 27.9 bits (59), Expect = 4.2 Identities = 15/56 (26%), Positives = 22/56 (39%) Frame = -2 Query: 193 PYDTGDESARHXXXXXXXXXXXXSARWRTTHITNCFCLPTHSGRTYITRRRSTNSY 26 PY+TG+ R ARW+ + L THS R ++ S + Y Sbjct: 125 PYETGEWEGRKCPPSTPFAAAPPLARWKERASVSSRRLSTHSSRRLMSSSSSDDEY 180 >09_02_0587 - 10948888-10949124,10949281-10949393,10949830-10950293, 10951223-10951766,10951902-10951971 Length = 475 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -2 Query: 100 ITNCFCLPTHSGRTYITRRRS 38 + NC+ LPT +G Y+ R RS Sbjct: 86 VRNCYALPTVAGAKYLVRVRS 106 >08_01_0433 + 3794440-3794948,3795696-3796707 Length = 506 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -2 Query: 370 PAILLDPPHSYFYVNQVLVMIRYGGRRRRDVIAV 269 PA+ PP S + NQ + + GG V+AV Sbjct: 208 PAMTFYPPFSKLFANQKMEFLLLGGNHSNAVVAV 241 >04_04_0418 + 25077748-25078101,25079413-25079538,25080683-25081593, 25081970-25082453 Length = 624 Score = 27.5 bits (58), Expect = 5.6 Identities = 14/58 (24%), Positives = 25/58 (43%) Frame = +2 Query: 35 SATPARYVRSTRVRRQTKTISDMSCAPSSTVFRLTILILTFIVTCTFIASVVWLLQTR 208 SA A Y+ +Q + + S FRLT + + C + SVV++ + + Sbjct: 546 SALLAGYIYDKEAAKQQPGVLEPSTCLGPDCFRLTFYVCAIVCCCGTLVSVVFIARIK 603 >01_06_1086 - 34421837-34422311,34422426-34422612,34423162-34423291, 34423485-34423720,34423804-34423961,34424048-34424128, 34424216-34424281,34424364-34424432,34424722-34424866, 34425645-34426138,34426244-34426811,34429529-34429574 Length = 884 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -2 Query: 94 NCFCLPTHSGRTYITRRRST-NSYVALRAS 8 NC+ +P+ SG+ Y+ R T +Y LR+S Sbjct: 79 NCYTIPSTSGKKYLIRTTFTYGNYDGLRSS 108 >09_03_0005 + 11411828-11411894,11412122-11412677,11413424-11413433 Length = 210 Score = 27.1 bits (57), Expect = 7.3 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -2 Query: 100 ITNCFCLPTHSGRTYITR 47 + NC+ LPT++G Y+ R Sbjct: 85 VRNCYALPTNAGNKYLVR 102 >09_02_0592 - 11006346-11006758,11012943-11013036 Length = 168 Score = 27.1 bits (57), Expect = 7.3 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 Query: 94 NCFCLPTHSGRTYITR 47 NC+ LPTH G Y+ R Sbjct: 100 NCYSLPTHIGSKYLVR 115 >03_06_0327 - 33158131-33158315,33158586-33158639,33159149-33159180, 33159275-33159369,33159466-33159539,33159643-33159778, 33159874-33159937,33160017-33160079,33160160-33160299, 33160487-33160627,33160747-33160868,33160947-33161112, 33161194-33161313,33161580-33161651,33161787-33161843, 33162036-33162152,33162231-33162369,33162794-33162900, 33162972-33163081,33163172-33163305,33163397-33163546, 33163635-33163840,33166123-33166818 Length = 1059 Score = 27.1 bits (57), Expect = 7.3 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = -3 Query: 168 HVTMKVNMRIVNRNTVLDGAQLISLIVFV 82 +V +K+N+++ RNTVL+ A + + I FV Sbjct: 724 NVALKINVKVGGRNTVLERAFIRNGIPFV 752 >08_01_0434 + 3809681-3810016,3810039-3811100 Length = 465 Score = 26.6 bits (56), Expect = 9.7 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -2 Query: 370 PAILLDPPHSYFYVNQVLVMIRYGGRRRRDVIAV 269 PA+ PP S + NQ + + GG V+AV Sbjct: 160 PAMTFYPPFSTLFGNQKMEFLLLGGNHNNAVVAV 193 >01_06_1089 - 34451982-34452670,34452755-34452814,34453287-34453352, 34454055-34454253,34454470-34454719,34454830-34454898, 34455733-34455804,34456027-34456168,34456544-34457064, 34457166-34457739,34459164-34459269 Length = 915 Score = 26.6 bits (56), Expect = 9.7 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 94 NCFCLPTHSGRTYITRRRST-NSYVALRAS 8 NC+ LPT+S + Y+ R T +Y L +S Sbjct: 101 NCYTLPTNSSKKYLIRATFTYGNYDGLNSS 130 >01_06_1088 - 34439311-34439987,34440080-34440136,34442790-34442919, 34443499-34443740,34443857-34444008,34444381-34444461, 34444547-34444612,34444692-34444763,34444843-34444984, 34445146-34445645,34446625-34447192,34447248-34447257 Length = 898 Score = 26.6 bits (56), Expect = 9.7 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 94 NCFCLPTHSGRTYITRRRST-NSYVALRAS 8 NC+ LPT+S + Y+ R T +Y L +S Sbjct: 67 NCYTLPTNSSKKYLIRATFTYGNYDGLNSS 96 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,014,090 Number of Sequences: 37544 Number of extensions: 161256 Number of successful extensions: 435 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 431 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 434 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 919380308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -