BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_G06 (485 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 3.0 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 3.0 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 3.0 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 3.0 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 3.0 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 3.0 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 3.0 AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. 22 3.0 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 3.0 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 3.0 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 3.0 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 3.0 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 3.0 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 3.0 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 3.0 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 3.0 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 3.0 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 3.0 AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. 22 3.0 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 21 5.3 AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 21 5.3 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 5.3 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 7.0 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 9.2 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 3.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 380 PYRPRILPPGFYSRTP 333 P+ PR +PP Y P Sbjct: 127 PFPPRFIPPDMYRLRP 142 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 3.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 380 PYRPRILPPGFYSRTP 333 P+ PR +PP Y P Sbjct: 127 PFPPRFIPPDMYRLRP 142 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 3.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 380 PYRPRILPPGFYSRTP 333 P+ PR +PP Y P Sbjct: 127 PFPPRFIPPDMYRLRP 142 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 3.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 380 PYRPRILPPGFYSRTP 333 P+ PR +PP Y P Sbjct: 127 PFPPRFIPPDMYRLRP 142 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 3.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 380 PYRPRILPPGFYSRTP 333 P+ PR +PP Y P Sbjct: 127 PFPPRFIPPDMYRLRP 142 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 3.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 380 PYRPRILPPGFYSRTP 333 P+ PR +PP Y P Sbjct: 127 PFPPRFIPPDMYRLRP 142 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 3.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 380 PYRPRILPPGFYSRTP 333 P+ PR +PP Y P Sbjct: 127 PFPPRFIPPDMYRLRP 142 >AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. Length = 136 Score = 22.2 bits (45), Expect = 3.0 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = -1 Query: 398 YGFHSLPYRPRILPPG 351 Y F PY P PPG Sbjct: 58 YNFQLKPYNPEHKPPG 73 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 3.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 73 PVTGSISPAPDPFHHRIRNN 14 PV+GS P P P + +NN Sbjct: 1852 PVSGSPEPPPPPPRNHDQNN 1871 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 380 PYRPRILPPGFYSRTP 333 P+ PR +PP Y P Sbjct: 376 PFPPRFIPPDMYRLRP 391 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 380 PYRPRILPPGFYSRTP 333 P+ PR +PP Y P Sbjct: 376 PFPPRFIPPDMYRLRP 391 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 380 PYRPRILPPGFYSRTP 333 P+ PR +PP Y P Sbjct: 376 PFPPRFIPPDMYRLRP 391 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 380 PYRPRILPPGFYSRTP 333 P+ PR +PP Y P Sbjct: 376 PFPPRFIPPDMYRLRP 391 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 380 PYRPRILPPGFYSRTP 333 P+ PR +PP Y P Sbjct: 376 PFPPRFIPPDMYRLRP 391 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 380 PYRPRILPPGFYSRTP 333 P+ PR +PP Y P Sbjct: 376 PFPPRFIPPDMYRLRP 391 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 3.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 380 PYRPRILPPGFYSRTP 333 P+ PR +PP Y P Sbjct: 375 PFPPRFIPPDMYRLRP 390 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.2 bits (45), Expect = 3.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 380 PYRPRILPPGFYSRTP 333 P+ PR +PP Y P Sbjct: 360 PFPPRFIPPDMYRLRP 375 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 3.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 380 PYRPRILPPGFYSRTP 333 P+ PR +PP Y P Sbjct: 376 PFPPRFIPPDMYRLRP 391 >AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. Length = 135 Score = 22.2 bits (45), Expect = 3.0 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = -1 Query: 398 YGFHSLPYRPRILPPG 351 Y F PY P PPG Sbjct: 59 YNFQLKPYNPEHKPPG 74 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.4 bits (43), Expect = 5.3 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = -3 Query: 399 IWVPFAPLSTTYITTWLLLSDTA 331 IWV F PL + W ++ A Sbjct: 222 IWVYFVPLFLIIYSYWFIIQAVA 244 >AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodopsin protein. Length = 154 Score = 21.4 bits (43), Expect = 5.3 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = -3 Query: 399 IWVPFAPLSTTYITTWLLLSDTA 331 IWV F PL + W ++ A Sbjct: 98 IWVYFVPLFLIIYSYWFIIQAVA 120 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 5.3 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = +2 Query: 170 YFKLSRREDKDGHVAMLFNKSEQDIKNNQQ 259 Y++L ++ K+G + ++S Q NN + Sbjct: 971 YYELEVKDQKNGKPPSVVSRSTQTSANNDK 1000 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.0 bits (42), Expect = 7.0 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -1 Query: 470 SIRCQSVLFSLHRRLEKQLIPKRIYGFHSLPY 375 SI CQ V ++H+R + + + H Y Sbjct: 12 SIACQDVTSAIHQRKSSKNLEHSMNVIHEWKY 43 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 20.6 bits (41), Expect = 9.2 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 179 LSRREDKDGHVAMLFNKSEQDIKNNQQAFITSLHSLLGNKPN 304 +S ++ GH+ +K E+D+ N + L G+ P+ Sbjct: 55 ISSHDELPGHINCDSSKFEEDLMNKLPTTPEYNNHLYGSTPD 96 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,926 Number of Sequences: 438 Number of extensions: 2983 Number of successful extensions: 24 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13297932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -