BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_G05 (519 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53148-5|AAB37076.1| 130|Caenorhabditis elegans Ribosomal prote... 80 8e-16 U80452-4|AAB37860.1| 226|Caenorhabditis elegans Hypothetical pr... 30 1.1 U28741-7|AAO38645.1| 721|Caenorhabditis elegans Synapse defecti... 29 1.5 U28741-6|AAO21428.1| 942|Caenorhabditis elegans Synapse defecti... 29 1.5 U28741-5|AAO38644.1| 987|Caenorhabditis elegans Synapse defecti... 29 1.5 AF546880-1|AAN38752.1| 942|Caenorhabditis elegans axon identity... 29 1.5 AF036705-9|AAO91724.1| 686|Caenorhabditis elegans Hypothetical ... 27 6.1 Z81043-4|CAB02798.1| 179|Caenorhabditis elegans Hypothetical pr... 27 8.0 >U53148-5|AAB37076.1| 130|Caenorhabditis elegans Ribosomal protein, small subunitprotein 30 protein. Length = 130 Score = 80.2 bits (189), Expect = 8e-16 Identities = 51/135 (37%), Positives = 69/135 (51%), Gaps = 5/135 (3%) Frame = +3 Query: 57 MQLHIRG--QSTHVLDVNGQESIGDIKNRLRLLADVESEEVTLSMCGAPLEDSCLVSEL- 227 MQ+ + G +TH LDV+ ++ IK + EE ++S L + + E Sbjct: 1 MQIFLLGLDNTTHTLDVDASTTLSAIKGVIGA-----GEEFSISYGSKVLSEELTLGECQ 55 Query: 228 --SSTELDLTVPLLGGKVHGSLARAGKVKGQTPXXXXXXXXXXXXXXXXXXIQYNRRFVN 401 S + L + LLGGKVHGSLARAGKV+ QTP +QY RR+VN Sbjct: 56 IESLSTLSVNGRLLGGKVHGSLARAGKVRAQTPKVDKQDKKKKKRGRAFRRVQYTRRYVN 115 Query: 402 VVQTFGRRRGPNSNS 446 V G++RGPNSNS Sbjct: 116 VASGPGKKRGPNSNS 130 >U80452-4|AAB37860.1| 226|Caenorhabditis elegans Hypothetical protein C16C8.4 protein. Length = 226 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = +3 Query: 84 THVLDVNGQESIGDIKNRLRLLADVESEEVTLSMCGAPLEDSCLVSE 224 ++ ++ ++++ DIKN + D+ LS G LED C + + Sbjct: 164 SYAFKIHREDTVFDIKNDIEHRHDIPQHSYWLSFSGKRLEDHCSIGD 210 >U28741-7|AAO38645.1| 721|Caenorhabditis elegans Synapse defective protein 1, isoformc protein. Length = 721 Score = 29.5 bits (63), Expect = 1.5 Identities = 16/63 (25%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = +3 Query: 120 GDIKNRLRLLADVESEEVTLSMCGAPLEDSCLVSELSSTEL-DLTVPLLGGKVHGSLARA 296 G ++ + L A++ES + + + D+ +++ L L +L PL+ ++HG L A Sbjct: 528 GSVEKKKMLRAELESNPLGTELAAESIPDTNVIACLIKDFLRELPEPLISPQIHGMLLEA 587 Query: 297 GKV 305 V Sbjct: 588 ASV 590 >U28741-6|AAO21428.1| 942|Caenorhabditis elegans Synapse defective protein 1, isoformb protein. Length = 942 Score = 29.5 bits (63), Expect = 1.5 Identities = 16/63 (25%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = +3 Query: 120 GDIKNRLRLLADVESEEVTLSMCGAPLEDSCLVSELSSTEL-DLTVPLLGGKVHGSLARA 296 G ++ + L A++ES + + + D+ +++ L L +L PL+ ++HG L A Sbjct: 726 GSVEKKKMLRAELESNPLGTELAAESIPDTNVIACLIKDFLRELPEPLISPQIHGMLLEA 785 Query: 297 GKV 305 V Sbjct: 786 ASV 788 >U28741-5|AAO38644.1| 987|Caenorhabditis elegans Synapse defective protein 1, isoforma protein. Length = 987 Score = 29.5 bits (63), Expect = 1.5 Identities = 16/63 (25%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = +3 Query: 120 GDIKNRLRLLADVESEEVTLSMCGAPLEDSCLVSELSSTEL-DLTVPLLGGKVHGSLARA 296 G ++ + L A++ES + + + D+ +++ L L +L PL+ ++HG L A Sbjct: 794 GSVEKKKMLRAELESNPLGTELAAESIPDTNVIACLIKDFLRELPEPLISPQIHGMLLEA 853 Query: 297 GKV 305 V Sbjct: 854 ASV 856 >AF546880-1|AAN38752.1| 942|Caenorhabditis elegans axon identity specification proteinSYD-1 protein. Length = 942 Score = 29.5 bits (63), Expect = 1.5 Identities = 16/63 (25%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = +3 Query: 120 GDIKNRLRLLADVESEEVTLSMCGAPLEDSCLVSELSSTEL-DLTVPLLGGKVHGSLARA 296 G ++ + L A++ES + + + D+ +++ L L +L PL+ ++HG L A Sbjct: 726 GSVEKKKMLRAELESNPLGTELAAESIPDTNVIACLIKDFLRELPEPLISPQIHGMLLEA 785 Query: 297 GKV 305 V Sbjct: 786 ASV 788 >AF036705-9|AAO91724.1| 686|Caenorhabditis elegans Hypothetical protein F37C4.2 protein. Length = 686 Score = 27.5 bits (58), Expect = 6.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -3 Query: 376 ILRLARPVLFFFFCCFSTLGVWPLTLPA 293 IL+ ++PV +F + V+P TLPA Sbjct: 257 ILKFSQPVSYFALVILLAINVFPFTLPA 284 >Z81043-4|CAB02798.1| 179|Caenorhabditis elegans Hypothetical protein C29F3.5 protein. Length = 179 Score = 27.1 bits (57), Expect = 8.0 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 355 VLFFFFCCFSTLGVWPLTLPARARDPCTLP 266 ++F FFC FS G P+T P +P +P Sbjct: 6 IIFAFFCMFSVEGCIPMTPP---EEPVVVP 32 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,639,449 Number of Sequences: 27780 Number of extensions: 219124 Number of successful extensions: 662 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 634 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 661 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1007108110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -