BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_G03 (520 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32805| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-05 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 41 5e-04 SB_8749| Best HMM Match : SCP (HMM E-Value=4.9e-16) 37 0.009 SB_21899| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.011 SB_7378| Best HMM Match : SCP (HMM E-Value=3.3e-29) 37 0.011 SB_9137| Best HMM Match : SCP (HMM E-Value=3.6e-18) 36 0.020 SB_59700| Best HMM Match : SCP (HMM E-Value=1.6e-14) 35 0.046 SB_57943| Best HMM Match : SCP (HMM E-Value=5.70048e-42) 35 0.046 SB_8748| Best HMM Match : Astacin (HMM E-Value=0) 35 0.046 SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) 34 0.061 SB_7926| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.061 SB_887| Best HMM Match : SCP (HMM E-Value=7.1e-25) 34 0.081 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 33 0.11 SB_55473| Best HMM Match : SCP (HMM E-Value=1.6e-22) 33 0.19 SB_47116| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_27401| Best HMM Match : SCP (HMM E-Value=9e-23) 32 0.33 SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_41526| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.75 SB_3100| Best HMM Match : SCP (HMM E-Value=1.5e-20) 31 0.75 SB_41991| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.00 SB_6144| Best HMM Match : SCP (HMM E-Value=4.6e-38) 30 1.00 SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_11891| Best HMM Match : F5_F8_type_C (HMM E-Value=4.7e-35) 30 1.3 SB_4646| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_12270| Best HMM Match : Big_2 (HMM E-Value=8.1) 29 3.0 SB_4966| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_37501| Best HMM Match : SCP (HMM E-Value=1.2e-19) 28 4.0 SB_41| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_57379| Best HMM Match : SCP (HMM E-Value=5.8e-19) 28 5.3 SB_15991| Best HMM Match : SCP (HMM E-Value=2.3e-23) 27 7.0 SB_21314| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 >SB_32805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 44.4 bits (100), Expect = 6e-05 Identities = 24/64 (37%), Positives = 33/64 (51%) Frame = +1 Query: 322 GENLYWYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAWSES 501 GENLY TT T D A++SW++E +Y Y + IGH+TQ+ W + Sbjct: 126 GENLYNKGTTSGTVSTCQD-AVDSWYSEIDNYDYTDYT----NHPGGVIGHFTQIVWKST 180 Query: 502 THVG 513 T VG Sbjct: 181 TEVG 184 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 41.1 bits (92), Expect = 5e-04 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = +1 Query: 361 YKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAWSESTHVGCA 519 Y L D A E W++E KDY + L + K GH+TQ+ W + +G A Sbjct: 3699 YDLRGDKAAEMWYDEVKDYNFETLAYN------AKCGHFTQLVWRGTKEIGVA 3745 >SB_8749| Best HMM Match : SCP (HMM E-Value=4.9e-16) Length = 369 Score = 37.1 bits (82), Expect = 0.009 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = +1 Query: 322 GENL-YWYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAWSE 498 GENL Y DS + +V +E+W+NE K Y + SD GH+TQ+ W Sbjct: 284 GENLGYSCVKPDSGHDCSV--TVEAWYNEVKKYDFNSPGFSD------PTGHFTQVVWKA 335 Query: 499 STHVG 513 ST +G Sbjct: 336 STELG 340 >SB_21899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 36.7 bits (81), Expect = 0.011 Identities = 19/66 (28%), Positives = 32/66 (48%) Frame = +1 Query: 322 GENLYWYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAWSES 501 GEN+ W + + T +L A+++W +E YK + + H+TQ+ W + Sbjct: 79 GENIAWAESQEITCEL----AVQAWMDELNIYKSDGYCANPPSMPDHNVMHFTQIVWKST 134 Query: 502 THVGCA 519 T VG A Sbjct: 135 TKVGVA 140 >SB_7378| Best HMM Match : SCP (HMM E-Value=3.3e-29) Length = 264 Score = 36.7 bits (81), Expect = 0.011 Identities = 26/97 (26%), Positives = 36/97 (37%) Frame = +1 Query: 223 WDEELXXXXXXXXXQNKNFHNPDKTLGSGRFQTGENLYWYSTTDSTYKLNVDNAMESWFN 402 W +EL + + + R GENL +S Y D A E W+ Sbjct: 140 WSDELAREAQYYAEKLAQQRSMQHSSKCSRNDAGENLAMFS---GRYDTAGDMACEMWYE 196 Query: 403 EYKDYKYAPLKQSDFDKSKPKIGHYTQMAWSESTHVG 513 E K Y + + F GH+TQM W S +G Sbjct: 197 ESKKYSFV---RGGFQGGT---GHFTQMVWKGSKELG 227 >SB_9137| Best HMM Match : SCP (HMM E-Value=3.6e-18) Length = 708 Score = 35.9 bits (79), Expect = 0.020 Identities = 20/67 (29%), Positives = 32/67 (47%) Frame = +1 Query: 319 TGENLYWYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAWSE 498 +GEN+ + L A+E W+NE + Y +A + + PK H+ QM W + Sbjct: 591 SGENIAQLRANPDSLHL-ARKAVELWYNEVRSYSFA------YPQLTPKDRHFVQMIWRK 643 Query: 499 STHVGCA 519 + VG A Sbjct: 644 TRAVGMA 650 >SB_59700| Best HMM Match : SCP (HMM E-Value=1.6e-14) Length = 427 Score = 34.7 bits (76), Expect = 0.046 Identities = 22/67 (32%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Frame = +1 Query: 316 QTGENLYWYSTTDSTYKLNVDNAMESWFNEYKDYKYA-PLKQSDFDKSKPKIGHYTQMAW 492 Q GEN S + +L + A + W+N+ Y Y+ P SD D +TQ+ W Sbjct: 300 QLGENRAKLSAVNYDCELAGEEAAKIWYNQGSHYSYSDPRLNSDTDS-------FTQLVW 352 Query: 493 SESTHVG 513 ES VG Sbjct: 353 KESRDVG 359 >SB_57943| Best HMM Match : SCP (HMM E-Value=5.70048e-42) Length = 632 Score = 34.7 bits (76), Expect = 0.046 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 2/68 (2%) Frame = +1 Query: 316 QTGENLY-WYSTTDSTYKLNVDNAMESWFNEYKDYKYA-PLKQSDFDKSKPKIGHYTQMA 489 Q GEN+Y + D +N + A++ W+NE +Y + P QS+ GH+TQ+ Sbjct: 53 QDGENIYVQFGQAD----INGEEAVDKWYNEVNNYDFGKPGFQSN-------TGHFTQVV 101 Query: 490 WSESTHVG 513 W ++ G Sbjct: 102 WRDTEEFG 109 >SB_8748| Best HMM Match : Astacin (HMM E-Value=0) Length = 757 Score = 34.7 bits (76), Expect = 0.046 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Frame = +1 Query: 322 GENLYWYSTT-DSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAWSE 498 GENL W D Y + A W+NE KDY + F + GH+TQ+ W Sbjct: 660 GENLAWGCFPGDKVY--SCVKATTEWYNEVKDYDF---NNPGFSGAT---GHFTQVVWKG 711 Query: 499 STHVG 513 S+ +G Sbjct: 712 SSELG 716 >SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) Length = 2123 Score = 34.3 bits (75), Expect = 0.061 Identities = 15/45 (33%), Positives = 29/45 (64%) Frame = +1 Query: 382 AMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAWSESTHVGC 516 A+++W +E KD+ ++ KQ DK ++ H+TQ+ W ++ +GC Sbjct: 1367 AIKAWHDEEKDFDWSSGKQ---DKDA-EVVHFTQVIWRKARRLGC 1407 >SB_7926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 34.3 bits (75), Expect = 0.061 Identities = 21/66 (31%), Positives = 32/66 (48%) Frame = +1 Query: 322 GENLYWYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAWSES 501 GENL + DS Y+L+ E W++E + Y++ F GH+TQ+ W S Sbjct: 24 GENLSF----DSGYELSGGRTTEMWYDEIQKYRF---NNPGFSSG---TGHFTQVVWVGS 73 Query: 502 THVGCA 519 +G A Sbjct: 74 QEMGVA 79 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 382 AMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAWSESTHVG 513 A + W+ E Y++ + F S GH+TQ+ W+ ST +G Sbjct: 217 ATDMWYGEVDKYRF---ENPGFSTSS---GHFTQVVWAGSTEMG 254 >SB_887| Best HMM Match : SCP (HMM E-Value=7.1e-25) Length = 147 Score = 33.9 bits (74), Expect = 0.081 Identities = 19/66 (28%), Positives = 32/66 (48%) Frame = +1 Query: 322 GENLYWYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAWSES 501 GENLY S ++ +N + ++ W++E YK+ D + GH+TQ+ W + Sbjct: 59 GENLYMCSPSE----INAGDIVDEWYSEISKYKF------DKPGWQSGTGHFTQVVWKGT 108 Query: 502 THVGCA 519 V A Sbjct: 109 KEVAMA 114 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 33.5 bits (73), Expect = 0.11 Identities = 28/113 (24%), Positives = 49/113 (43%), Gaps = 12/113 (10%) Frame = +1 Query: 217 MVWDEELXXXXXX----XXXQNKNFHNPD-KTLGSGRFQTGENLYWYSTT-------DST 360 + W+ EL +NK H+P K LG G ENL +++ + T Sbjct: 228 LTWNSELTRDAQSWADTLARENKFEHHPALKELGQG-----ENLAYFAPANRKCDGPEDT 282 Query: 361 YKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAWSESTHVGCA 519 ++ ++ W++E +DY + D + H+TQ+ W ++T VG A Sbjct: 283 NCVHCGEIVKDWYDEIRDYDFNKGAGKDMWSV---VLHFTQVVWRDTTEVGMA 332 >SB_55473| Best HMM Match : SCP (HMM E-Value=1.6e-22) Length = 141 Score = 32.7 bits (71), Expect = 0.19 Identities = 19/68 (27%), Positives = 33/68 (48%) Frame = +1 Query: 310 RFQTGENLYWYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMA 489 R+ GEN+ S + ++ +A++ W+NE + Y+Y D GH+TQ+ Sbjct: 71 RYYKGENICRMS-----HHFDIGDALQIWYNESESYQY------DNPGFALTTGHFTQIV 119 Query: 490 WSESTHVG 513 W + VG Sbjct: 120 WRGTREVG 127 >SB_47116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 361 YKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYT 480 Y+ N + ++ WF+E + Y Y K S + +P GHYT Sbjct: 44 YQKNPTDGVQDWFDERQHYTYG--KHSPRNCRRPSCGHYT 81 >SB_27401| Best HMM Match : SCP (HMM E-Value=9e-23) Length = 1105 Score = 31.9 bits (69), Expect = 0.33 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +1 Query: 370 NVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAWSESTHVG 513 ++++A+ W+NE Y +A +P H+TQM W S +G Sbjct: 606 SINDAINKWYNEVCKYDFAS------GGPQPGANHFTQMVWKGSKKIG 647 >SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2323 Score = 31.9 bits (69), Expect = 0.33 Identities = 17/61 (27%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Frame = +1 Query: 337 WYSTTDSTYKLNVDNAMESWFNEYKD-YKYAPLKQSDFDKSKPKIGHYTQMAWSESTHVG 513 W T K + A++ W++E KD Y + K + IGH+ + W T +G Sbjct: 194 WGWTGQKVMKGAIPGAVQGWYSEIKDDYNFKTGKGAP----GKAIGHFQAVVWKGETKLG 249 Query: 514 C 516 C Sbjct: 250 C 250 Score = 31.1 bits (67), Expect = 0.57 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Frame = +1 Query: 322 GENLYWYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKS--KPKIGHYTQMAWS 495 GENL W+ + S + + A+ W+NE Y DF+K GH+TQ+ W Sbjct: 646 GENL-WFMCSSSKEQ-TPEKAVTDWYNEICKPGY------DFNKPGFSSGTGHFTQVVWK 697 Query: 496 ESTHVG 513 S +G Sbjct: 698 GSVELG 703 >SB_41526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 30.7 bits (66), Expect = 0.75 Identities = 18/54 (33%), Positives = 24/54 (44%) Frame = +1 Query: 352 DSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAWSESTHVG 513 D KL VD W+ E +Y + S P GH+TQ+ W ST +G Sbjct: 5 DENCKLGVD----LWYKESNNYDFQSPGYS------PATGHFTQLVWKASTRMG 48 >SB_3100| Best HMM Match : SCP (HMM E-Value=1.5e-20) Length = 191 Score = 30.7 bits (66), Expect = 0.75 Identities = 16/64 (25%), Positives = 31/64 (48%) Frame = +1 Query: 322 GENLYWYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAWSES 501 GENL + ++ L + A+ W++E Y + KQ + + GH+T + W ++ Sbjct: 74 GENLIYRCSSGPGEVLPAEKAVTDWYDEICMYNF---KQPGY---YSRTGHFTALVWKDT 127 Query: 502 THVG 513 +G Sbjct: 128 KELG 131 >SB_41991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 30.3 bits (65), Expect = 1.00 Identities = 18/56 (32%), Positives = 31/56 (55%) Frame = +1 Query: 316 QTGENLYWYSTTDSTYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQ 483 Q GENLY + S+ + ++A + W+ E DY + + +++S IGH+TQ Sbjct: 731 QYGENLY--GSVSSSGAGSCEDATDLWYAEIADYDW-----NYYNQSTGVIGHFTQ 779 >SB_6144| Best HMM Match : SCP (HMM E-Value=4.6e-38) Length = 468 Score = 30.3 bits (65), Expect = 1.00 Identities = 15/53 (28%), Positives = 25/53 (47%) Frame = +1 Query: 355 STYKLNVDNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAWSESTHVG 513 S K+ D + + D Y + DF+ +P IG ++Q+ W ST +G Sbjct: 181 SNTKIECDGTQDDGI-QVVDSWYKDVCNYDFNAHQPVIGLFSQLVWKSSTSLG 232 Score = 29.1 bits (62), Expect = 2.3 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 421 YAPLKQSDFDKSKPKIGHYTQMAWSESTHVG 513 Y + DF+ +P IG ++Q+ W ST +G Sbjct: 2 YKDVCNYDFNTHQPVIGLFSQLVWKSSTSLG 32 >SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +1 Query: 382 AMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAWSESTHVG 513 A+E W+ E Y + ++ GH+TQ+ W EST +G Sbjct: 282 AVEMWYKEVCMYNF------NYGGMSGATGHFTQLVWKESTLLG 319 >SB_11891| Best HMM Match : F5_F8_type_C (HMM E-Value=4.7e-35) Length = 1171 Score = 29.9 bits (64), Expect = 1.3 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +2 Query: 299 WDREDSRLVKICIGIQRPIAHTN*MWTTLWRVG 397 WD + +V+ C G RPI +W+ L++ G Sbjct: 115 WDYMEDNIVRFCEGTIRPILSEEGVWSPLYKSG 147 >SB_4646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 329 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -3 Query: 185 DT*PLASNCLL*LCPL-TKSLICLHDKFSRDLLWTCP 78 D P + +L +CP T+ ++ + +F+RD+L TCP Sbjct: 82 DLCPRGTRDMLEMCPRGTRDMLVMCPRFNRDMLETCP 118 >SB_12270| Best HMM Match : Big_2 (HMM E-Value=8.1) Length = 112 Score = 28.7 bits (61), Expect = 3.0 Identities = 10/19 (52%), Positives = 17/19 (89%) Frame = +2 Query: 404 NIKITNMLP*NRVTSTSLN 460 N+K+TN++P +RVTS ++N Sbjct: 46 NVKLTNIMPSSRVTSVTIN 64 >SB_4966| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1044 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +1 Query: 373 VDNAMESWFNEYK-DYKYAPLKQSDFDKSKPKIGHYTQMAWSESTHVGC 516 + A+ W++E K DY Y Q+ K +GH+ + W +GC Sbjct: 511 IPGAVRGWYSEIKNDYNY----QTGKGNGKA-VGHFQAVVWKSIEKIGC 554 >SB_37501| Best HMM Match : SCP (HMM E-Value=1.2e-19) Length = 351 Score = 28.3 bits (60), Expect = 4.0 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 469 GHYTQMAWSESTHVG 513 GH+TQ+ W EST +G Sbjct: 163 GHFTQVVWKESTELG 177 >SB_41| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 28.3 bits (60), Expect = 4.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 146 CPLTKSLICLHDKFSRDLLWTCPIHTTI 63 CP TK+ C H+K ++ + CP + Sbjct: 235 CPFTKATCCTHNKCCKEGTFCCPTEPAV 262 >SB_57379| Best HMM Match : SCP (HMM E-Value=5.8e-19) Length = 168 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +1 Query: 382 AMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAWSESTHVG 513 A+E W +E DY S D + H+TQ+ W + +G Sbjct: 97 AVEYWMDEKYDYHAKGYCLSPPDLPDSYLLHFTQVVWKATRRIG 140 >SB_15991| Best HMM Match : SCP (HMM E-Value=2.3e-23) Length = 1189 Score = 27.5 bits (58), Expect = 7.0 Identities = 11/46 (23%), Positives = 22/46 (47%) Frame = +1 Query: 376 DNAMESWFNEYKDYKYAPLKQSDFDKSKPKIGHYTQMAWSESTHVG 513 + A+ +W+ E K+Y + S P H++Q+ W + +G Sbjct: 412 ERAVRNWYQEVKNYDFKN------PHSDPSTSHFSQLVWKGTKKLG 451 >SB_21314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 586 Score = 27.1 bits (57), Expect = 9.3 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +1 Query: 373 VDNAMESWFNEYKDYKYAPLKQSDFDKSK 459 VD++++SWF++Y D+ ++F+ K Sbjct: 288 VDSSVKSWFDDYMDWAKVSKPAANFNAGK 316 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,660,961 Number of Sequences: 59808 Number of extensions: 328545 Number of successful extensions: 731 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 678 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 719 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1160542895 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -