SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0001_F20
         (476 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY819656-1|AAV70656.1|   56|Tribolium castaneum elongation facto...    22   3.3  
AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory recept...    21   7.7  
AM292356-1|CAL23168.2|  251|Tribolium castaneum gustatory recept...    21   7.7  

>AY819656-1|AAV70656.1|   56|Tribolium castaneum elongation factor
           1-alpha protein.
          Length = 56

 Score = 21.8 bits (44), Expect = 3.3
 Identities = 11/33 (33%), Positives = 15/33 (45%)
 Frame = +3

Query: 342 KSGDIITLHPNKAYNDFLLPGLAVYATPENLET 440
           K G I T+   +     L PG+ V   P N+ T
Sbjct: 6   KIGGIGTVPVGRVETGVLKPGMVVVFAPANITT 38


>AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory receptor
           candidate 51 protein.
          Length = 771

 Score = 20.6 bits (41), Expect = 7.7
 Identities = 7/13 (53%), Positives = 12/13 (92%)
 Frame = -1

Query: 62  LRTLYKYFIIYLI 24
           +RT++K+F I+LI
Sbjct: 408 MRTVWKFFNIFLI 420


>AM292356-1|CAL23168.2|  251|Tribolium castaneum gustatory receptor
           candidate 35 protein.
          Length = 251

 Score = 20.6 bits (41), Expect = 7.7
 Identities = 9/12 (75%), Positives = 11/12 (91%)
 Frame = -2

Query: 310 IFISVAFLIFVS 275
           I IS+AF+IFVS
Sbjct: 8   ITISMAFIIFVS 19


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 120,051
Number of Sequences: 336
Number of extensions: 2765
Number of successful extensions: 6
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 52
effective length of database: 105,113
effective search space used: 11141978
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -