BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_F20 (476 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC004517-1|AAH04517.1| 267|Homo sapiens mitochondrial ribosomal... 81 1e-15 AL589765-10|CAI17172.1| 233|Homo sapiens mitochondrial ribosoma... 81 1e-15 AL589765-9|CAI17171.1| 267|Homo sapiens mitochondrial ribosomal... 81 1e-15 AB049636-1|BAB40841.1| 267|Homo sapiens mitochondrial ribosomal... 81 1e-15 BC038507-1|AAH38507.2| 669|Homo sapiens GLS protein protein. 31 2.7 AF327434-1|AAG47842.1| 669|Homo sapiens glutaminase protein. 31 2.7 AF223943-1|AAF33825.1| 669|Homo sapiens glutaminase kidney isof... 31 2.7 AF158555-1|AAD47056.1| 598|Homo sapiens glutaminase C protein. 31 2.7 AF097493-1|AAF00089.1| 330|Homo sapiens glutaminase kidney isof... 31 2.7 AF097492-1|AAF00088.1| 527|Homo sapiens glutaminase isoform C p... 31 2.7 AC067945-1|AAY24182.1| 292|Homo sapiens unknown protein. 31 2.7 AB020645-1|BAA74861.2| 677|Homo sapiens KIAA0838 protein protein. 31 2.7 BC037278-1|AAH37278.1| 496|Homo sapiens transmembrane protein 1... 30 3.6 AK074029-1|BAB84855.1| 508|Homo sapiens FLJ00021 protein protein. 30 3.6 >BC004517-1|AAH04517.1| 267|Homo sapiens mitochondrial ribosomal protein L9 protein. Length = 267 Score = 81.4 bits (192), Expect = 1e-15 Identities = 41/97 (42%), Positives = 61/97 (62%) Frame = +3 Query: 165 QTRNTFILKRRWPPPLHKRGGKVPKMKGRHFVYDLVEDTNIRKATDMKIILTQFVDGIGK 344 Q R T I++R W PL G K P++ RH VY LVEDT R ++++ILTQ V+ +G Sbjct: 49 QNRGTVIVERWWKVPLAGEGRK-PRLHRRHRVYKLVEDTKHRPKENLELILTQSVENVGV 107 Query: 345 SGDIITLHPNKAYNDFLLPGLAVYATPENLETFKVDE 455 GD++++ + N L GLAVYA+PEN + F+ ++ Sbjct: 108 RGDLVSVKKSLGRNRLLPQGLAVYASPENKKLFEEEK 144 >AL589765-10|CAI17172.1| 233|Homo sapiens mitochondrial ribosomal protein L9 protein. Length = 233 Score = 81.4 bits (192), Expect = 1e-15 Identities = 41/97 (42%), Positives = 61/97 (62%) Frame = +3 Query: 165 QTRNTFILKRRWPPPLHKRGGKVPKMKGRHFVYDLVEDTNIRKATDMKIILTQFVDGIGK 344 Q R T I++R W PL G K P++ RH VY LVEDT R ++++ILTQ V+ +G Sbjct: 49 QNRGTVIVERWWKVPLAGEGRK-PRLHRRHRVYKLVEDTKHRPKENLELILTQSVENVGV 107 Query: 345 SGDIITLHPNKAYNDFLLPGLAVYATPENLETFKVDE 455 GD++++ + N L GLAVYA+PEN + F+ ++ Sbjct: 108 RGDLVSVKKSLGRNRLLPQGLAVYASPENKKLFEEEK 144 >AL589765-9|CAI17171.1| 267|Homo sapiens mitochondrial ribosomal protein L9 protein. Length = 267 Score = 81.4 bits (192), Expect = 1e-15 Identities = 41/97 (42%), Positives = 61/97 (62%) Frame = +3 Query: 165 QTRNTFILKRRWPPPLHKRGGKVPKMKGRHFVYDLVEDTNIRKATDMKIILTQFVDGIGK 344 Q R T I++R W PL G K P++ RH VY LVEDT R ++++ILTQ V+ +G Sbjct: 49 QNRGTVIVERWWKVPLAGEGRK-PRLHRRHRVYKLVEDTKHRPKENLELILTQSVENVGV 107 Query: 345 SGDIITLHPNKAYNDFLLPGLAVYATPENLETFKVDE 455 GD++++ + N L GLAVYA+PEN + F+ ++ Sbjct: 108 RGDLVSVKKSLGRNRLLPQGLAVYASPENKKLFEEEK 144 >AB049636-1|BAB40841.1| 267|Homo sapiens mitochondrial ribosomal protein L9 (L9mt) protein. Length = 267 Score = 81.4 bits (192), Expect = 1e-15 Identities = 41/97 (42%), Positives = 61/97 (62%) Frame = +3 Query: 165 QTRNTFILKRRWPPPLHKRGGKVPKMKGRHFVYDLVEDTNIRKATDMKIILTQFVDGIGK 344 Q R T I++R W PL G K P++ RH VY LVEDT R ++++ILTQ V+ +G Sbjct: 49 QNRGTVIVERWWKVPLAGEGRK-PRLHRRHRVYKLVEDTKHRPKENLELILTQSVENVGV 107 Query: 345 SGDIITLHPNKAYNDFLLPGLAVYATPENLETFKVDE 455 GD++++ + N L GLAVYA+PEN + F+ ++ Sbjct: 108 RGDLVSVKKSLGRNRLLPQGLAVYASPENKKLFEEEK 144 >BC038507-1|AAH38507.2| 669|Homo sapiens GLS protein protein. Length = 669 Score = 30.7 bits (66), Expect = 2.7 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 198 WPPPLHKRGGKVPKMKGRHFVYDLVEDTNIRKATDMK 308 W PPL K G V KG HF +DLV N +++ Sbjct: 501 WSPPLDKMGNSV---KGIHFCHDLVSLCNFHNYDNLR 534 >AF327434-1|AAG47842.1| 669|Homo sapiens glutaminase protein. Length = 669 Score = 30.7 bits (66), Expect = 2.7 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 198 WPPPLHKRGGKVPKMKGRHFVYDLVEDTNIRKATDMK 308 W PPL K G V KG HF +DLV N +++ Sbjct: 501 WSPPLDKMGNSV---KGIHFCHDLVSLCNFHNYDNLR 534 >AF223943-1|AAF33825.1| 669|Homo sapiens glutaminase kidney isoform protein. Length = 669 Score = 30.7 bits (66), Expect = 2.7 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 198 WPPPLHKRGGKVPKMKGRHFVYDLVEDTNIRKATDMK 308 W PPL K G V KG HF +DLV N +++ Sbjct: 501 WSPPLDKMGNSV---KGIHFCHDLVSLCNFHNYDNLR 534 >AF158555-1|AAD47056.1| 598|Homo sapiens glutaminase C protein. Length = 598 Score = 30.7 bits (66), Expect = 2.7 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 198 WPPPLHKRGGKVPKMKGRHFVYDLVEDTNIRKATDMK 308 W PPL K G V KG HF +DLV N +++ Sbjct: 501 WSPPLDKMGNSV---KGIHFCHDLVSLCNFHNYDNLR 534 >AF097493-1|AAF00089.1| 330|Homo sapiens glutaminase kidney isoform protein. Length = 330 Score = 30.7 bits (66), Expect = 2.7 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 198 WPPPLHKRGGKVPKMKGRHFVYDLVEDTNIRKATDMK 308 W PPL K G V KG HF +DLV N +++ Sbjct: 162 WSPPLDKMGNSV---KGIHFCHDLVSLCNFHNYDNLR 195 >AF097492-1|AAF00088.1| 527|Homo sapiens glutaminase isoform C protein. Length = 527 Score = 30.7 bits (66), Expect = 2.7 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 198 WPPPLHKRGGKVPKMKGRHFVYDLVEDTNIRKATDMK 308 W PPL K G V KG HF +DLV N +++ Sbjct: 430 WSPPLDKMGNSV---KGIHFCHDLVSLCNFHNYDNLR 463 >AC067945-1|AAY24182.1| 292|Homo sapiens unknown protein. Length = 292 Score = 30.7 bits (66), Expect = 2.7 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 198 WPPPLHKRGGKVPKMKGRHFVYDLVEDTNIRKATDMK 308 W PPL K G V KG HF +DLV N +++ Sbjct: 124 WSPPLDKMGNSV---KGIHFCHDLVSLCNFHNYDNLR 157 >AB020645-1|BAA74861.2| 677|Homo sapiens KIAA0838 protein protein. Length = 677 Score = 30.7 bits (66), Expect = 2.7 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 198 WPPPLHKRGGKVPKMKGRHFVYDLVEDTNIRKATDMK 308 W PPL K G V KG HF +DLV N +++ Sbjct: 509 WSPPLDKMGNSV---KGIHFCHDLVSLCNFHNYDNLR 542 >BC037278-1|AAH37278.1| 496|Homo sapiens transmembrane protein 104 protein. Length = 496 Score = 30.3 bits (65), Expect = 3.6 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -2 Query: 226 PPLLWSGGGHLLFKINVFLVCCSNKLGPLVTALLMKEH-TRNIFLN 92 PPL G LF + V+ C + L L+T + K H TR +FL+ Sbjct: 265 PPLADFSGVRNLFGVCVYSFMCQHSLPSLITPVSSKRHLTRLVFLD 310 >AK074029-1|BAB84855.1| 508|Homo sapiens FLJ00021 protein protein. Length = 508 Score = 30.3 bits (65), Expect = 3.6 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -2 Query: 226 PPLLWSGGGHLLFKINVFLVCCSNKLGPLVTALLMKEH-TRNIFLN 92 PPL G LF + V+ C + L L+T + K H TR +FL+ Sbjct: 277 PPLADFSGVRNLFGVCVYSFMCQHSLPSLITPVSSKRHLTRLVFLD 322 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,520,979 Number of Sequences: 237096 Number of extensions: 1536745 Number of successful extensions: 2814 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2810 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4213781852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -