BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_F17 (320 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY094841-1|AAM11194.1| 204|Drosophila melanogaster RE01373p pro... 99 6e-22 AF030251-1|AAB84223.1| 204|Drosophila melanogaster ribosomal L1... 99 6e-22 AY070969-1|AAL48591.1| 233|Drosophila melanogaster RE06857p pro... 29 1.8 AE014298-2476|AAF48662.2| 233|Drosophila melanogaster CG4742-PA... 29 1.8 AY069472-1|AAL39617.1| 731|Drosophila melanogaster LD21354p pro... 27 4.1 AF294395-1|AAG02485.1| 731|Drosophila melanogaster IkappaB kina... 27 4.1 AF190636-1|AAF04130.1| 751|Drosophila melanogaster IKK-like pro... 27 4.1 AF140766-1|AAF27291.1| 731|Drosophila melanogaster LPS-responsi... 27 4.1 AE014297-2139|AAF55267.2| 751|Drosophila melanogaster CG4201-PA... 27 4.1 AE013599-3329|AAF46798.2| 1056|Drosophila melanogaster CG11073-P... 27 4.1 BT029029-1|ABJ16962.1| 310|Drosophila melanogaster IP01723p pro... 27 5.4 BT001422-1|AAN71177.1| 750|Drosophila melanogaster GH13177p pro... 27 5.4 AF152361-1|AAF00151.1| 310|Drosophila melanogaster Kua protein ... 27 5.4 AE014296-1539|AAF50353.2| 887|Drosophila melanogaster CG5741-PA... 27 5.4 AE014134-3208|AAF53878.1| 310|Drosophila melanogaster CG10723-P... 27 5.4 BT024252-1|ABC86314.1| 358|Drosophila melanogaster IP15869p pro... 27 7.1 AF128403-1|AAF04348.1| 731|Drosophila melanogaster cactus kinas... 27 7.1 AY119640-1|AAM50294.1| 528|Drosophila melanogaster RE44079p pro... 26 9.4 AE014296-3243|AAN11640.1| 528|Drosophila melanogaster CG7757-PB... 26 9.4 AE014296-3242|AAF49097.1| 598|Drosophila melanogaster CG7757-PA... 26 9.4 >AY094841-1|AAM11194.1| 204|Drosophila melanogaster RE01373p protein. Length = 204 Score = 99 bits (238), Expect = 6e-22 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = +1 Query: 10 AIRRDPKINWIVNAVHKHREMRGLTSAGKSSRGLGKGHRFSQTKGGSRRAAW 165 AIRRDPKINWI VHKHRE+RGLTSAGKSSRG+GKG+R+SQT GGSRRAAW Sbjct: 141 AIRRDPKINWICKHVHKHRELRGLTSAGKSSRGIGKGYRYSQTIGGSRRAAW 192 >AF030251-1|AAB84223.1| 204|Drosophila melanogaster ribosomal L15 (YL10) protein homologueprotein. Length = 204 Score = 99 bits (238), Expect = 6e-22 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = +1 Query: 10 AIRRDPKINWIVNAVHKHREMRGLTSAGKSSRGLGKGHRFSQTKGGSRRAAW 165 AIRRDPKINWI VHKHRE+RGLTSAGKSSRG+GKG+R+SQT GGSRRAAW Sbjct: 141 AIRRDPKINWICKHVHKHRELRGLTSAGKSSRGIGKGYRYSQTIGGSRRAAW 192 >AY070969-1|AAL48591.1| 233|Drosophila melanogaster RE06857p protein. Length = 233 Score = 28.7 bits (61), Expect = 1.8 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +2 Query: 86 PQGKALVVSARDIASLKPREVPVAPPGYVATPCNCVAS 199 PQG AL+ SA D +S+ P PV+PP + + AS Sbjct: 16 PQGAALLRSA-DSSSISPAISPVSPPALQSKSLHTAAS 52 >AE014298-2476|AAF48662.2| 233|Drosophila melanogaster CG4742-PA protein. Length = 233 Score = 28.7 bits (61), Expect = 1.8 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +2 Query: 86 PQGKALVVSARDIASLKPREVPVAPPGYVATPCNCVAS 199 PQG AL+ SA D +S+ P PV+PP + + AS Sbjct: 16 PQGAALLRSA-DSSSISPAISPVSPPALQSKSLHTAAS 52 >AY069472-1|AAL39617.1| 731|Drosophila melanogaster LD21354p protein. Length = 731 Score = 27.5 bits (58), Expect = 4.1 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 114 QGTSLLSN-QGRFPSRRLVTSQHLATASQAINKTMDSALTFYSFL 245 Q TSLL Q + PSR+L++S ++ N + SA + SFL Sbjct: 516 QLTSLLKEAQAKIPSRQLISSAQWEKLNRNYNFIIQSAKSIRSFL 560 >AF294395-1|AAG02485.1| 731|Drosophila melanogaster IkappaB kinase beta protein. Length = 731 Score = 27.5 bits (58), Expect = 4.1 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 114 QGTSLLSN-QGRFPSRRLVTSQHLATASQAINKTMDSALTFYSFL 245 Q TSLL Q + PSR+L++S ++ N + SA + SFL Sbjct: 516 QLTSLLKEAQAKIPSRQLISSAQWEKLNRNYNFIIQSAKSIRSFL 560 >AF190636-1|AAF04130.1| 751|Drosophila melanogaster IKK-like protein protein. Length = 751 Score = 27.5 bits (58), Expect = 4.1 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 114 QGTSLLSN-QGRFPSRRLVTSQHLATASQAINKTMDSALTFYSFL 245 Q TSLL Q + PSR+L++S ++ N + SA + SFL Sbjct: 536 QLTSLLKEAQAKIPSRQLISSAQWEKLNRNYNFIIQSAKSIRSFL 580 >AF140766-1|AAF27291.1| 731|Drosophila melanogaster LPS-responsive kinase protein. Length = 731 Score = 27.5 bits (58), Expect = 4.1 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 114 QGTSLLSN-QGRFPSRRLVTSQHLATASQAINKTMDSALTFYSFL 245 Q TSLL Q + PSR+L++S ++ N + SA + SFL Sbjct: 516 QLTSLLKEAQAKIPSRQLISSAQWEKLNRNYNFIIQSAKSIRSFL 560 >AE014297-2139|AAF55267.2| 751|Drosophila melanogaster CG4201-PA protein. Length = 751 Score = 27.5 bits (58), Expect = 4.1 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 114 QGTSLLSN-QGRFPSRRLVTSQHLATASQAINKTMDSALTFYSFL 245 Q TSLL Q + PSR+L++S ++ N + SA + SFL Sbjct: 536 QLTSLLKEAQAKIPSRQLISSAQWEKLNRNYNFIIQSAKSIRSFL 580 >AE013599-3329|AAF46798.2| 1056|Drosophila melanogaster CG11073-PA protein. Length = 1056 Score = 27.5 bits (58), Expect = 4.1 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 117 GTSLLSNQGRFPSRRLVTSQHLATASQA 200 GT+ SN GRFP+R+ T+ + T S + Sbjct: 475 GTTTPSNPGRFPNRQRGTAHYSTTRSSS 502 >BT029029-1|ABJ16962.1| 310|Drosophila melanogaster IP01723p protein. Length = 310 Score = 27.1 bits (57), Expect = 5.4 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +2 Query: 86 PQGKALVVSARDIASLKPREVPVAPPGYVAT 178 P G + +D S+KP E+ V P G AT Sbjct: 19 PNGNLAPATTKDKESVKPEELKVTPAGTKAT 49 >BT001422-1|AAN71177.1| 750|Drosophila melanogaster GH13177p protein. Length = 750 Score = 27.1 bits (57), Expect = 5.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 169 VTRRRDGNLPWFERSDVPCRDHESFSLR 86 + +RR N P +R +P DH S+ LR Sbjct: 151 IPKRRMWNEPPIDRHKIPFTDHRSYDLR 178 >AF152361-1|AAF00151.1| 310|Drosophila melanogaster Kua protein protein. Length = 310 Score = 27.1 bits (57), Expect = 5.4 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +2 Query: 86 PQGKALVVSARDIASLKPREVPVAPPGYVAT 178 P G + +D S+KP E+ V P G AT Sbjct: 19 PNGNLAPATTKDKESVKPEELKVTPAGTKAT 49 >AE014296-1539|AAF50353.2| 887|Drosophila melanogaster CG5741-PA protein. Length = 887 Score = 27.1 bits (57), Expect = 5.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 169 VTRRRDGNLPWFERSDVPCRDHESFSLR 86 + +RR N P +R +P DH S+ LR Sbjct: 288 IPKRRMWNEPPIDRHKIPFTDHRSYDLR 315 >AE014134-3208|AAF53878.1| 310|Drosophila melanogaster CG10723-PA protein. Length = 310 Score = 27.1 bits (57), Expect = 5.4 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +2 Query: 86 PQGKALVVSARDIASLKPREVPVAPPGYVAT 178 P G + +D S+KP E+ V P G AT Sbjct: 19 PNGNLAPATTKDKESVKPEELKVTPAGTKAT 49 >BT024252-1|ABC86314.1| 358|Drosophila melanogaster IP15869p protein. Length = 358 Score = 26.6 bits (56), Expect = 7.1 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 206 VYRLRRSCKVLRRNQAARREP 144 V ++RR C LRR Q + REP Sbjct: 305 VLQVRRQCPQLRRRQDSHREP 325 >AF128403-1|AAF04348.1| 731|Drosophila melanogaster cactus kinase IKK protein. Length = 731 Score = 26.6 bits (56), Expect = 7.1 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 114 QGTSLLSN-QGRFPSRRLVTSQHLATASQAINKTMDSALTFYSFL 245 Q TSLL Q + PSR+L++S ++ N + SA + SFL Sbjct: 516 QLTSLLKEAQAKSPSRQLISSAQWEKLNRNYNFIIQSAKSIRSFL 560 >AY119640-1|AAM50294.1| 528|Drosophila melanogaster RE44079p protein. Length = 528 Score = 26.2 bits (55), Expect = 9.4 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -1 Query: 248 RQKRIESQCGIHCLVYRLR 192 R+ R ++ CG+H VYR+R Sbjct: 381 RKLREDTSCGVHVSVYRIR 399 >AE014296-3243|AAN11640.1| 528|Drosophila melanogaster CG7757-PB, isoform B protein. Length = 528 Score = 26.2 bits (55), Expect = 9.4 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -1 Query: 248 RQKRIESQCGIHCLVYRLR 192 R+ R ++ CG+H VYR+R Sbjct: 381 RKLREDTSCGVHVSVYRIR 399 >AE014296-3242|AAF49097.1| 598|Drosophila melanogaster CG7757-PA, isoform A protein. Length = 598 Score = 26.2 bits (55), Expect = 9.4 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -1 Query: 248 RQKRIESQCGIHCLVYRLR 192 R+ R ++ CG+H VYR+R Sbjct: 451 RKLREDTSCGVHVSVYRIR 469 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,029,809 Number of Sequences: 53049 Number of extensions: 267650 Number of successful extensions: 960 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 960 length of database: 24,988,368 effective HSP length: 74 effective length of database: 21,062,742 effective search space used: 674007744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -