BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_F17 (320 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 23 0.69 X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. 23 1.2 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 22 1.6 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 22 1.6 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 20 6.4 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 20 6.4 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 23.4 bits (48), Expect = 0.69 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +2 Query: 191 VASDKQDNGFRIDFLFVSVFIFKWKADVPNKIYFYL 298 + + NG +I V + I +WK VP+ + F+L Sbjct: 47 IEENNMPNGMQIWNDKVFITIPRWKNGVPSNLNFFL 82 >X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. Length = 103 Score = 22.6 bits (46), Expect = 1.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 79 LTSAGKSSRGLGKG 120 +T GK +GLGKG Sbjct: 1 MTGRGKGGKGLGKG 14 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 1.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 39 DRECGTQTSRDARSDVRREKL 101 +R C +R+ R D R EKL Sbjct: 1 ERSCSRDRNREYRKDRRYEKL 21 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 1.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 39 DRECGTQTSRDARSDVRREKL 101 +R C +R+ R D R EKL Sbjct: 1 ERSCSRDRNREYRKDRRYEKL 21 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 20.2 bits (40), Expect = 6.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 301 VQVKIYFIRHIGFPFEYK 248 V+ +I FI GFP EY+ Sbjct: 357 VKRRISFILVHGFPLEYE 374 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 20.2 bits (40), Expect = 6.4 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +1 Query: 46 NAVHKHREMRGLTSAGKSSRGLGKGHR 126 N+ K+RE S + RG + HR Sbjct: 287 NSYRKYRETSKERSRDRRERGRSREHR 313 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,220 Number of Sequences: 438 Number of extensions: 2130 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 6968808 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -