BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_F13 (345 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A6EMG0 Cluster: Putative uncharacterized protein; n=1; ... 30 9.2 >UniRef50_A6EMG0 Cluster: Putative uncharacterized protein; n=1; unidentified eubacterium SCB49|Rep: Putative uncharacterized protein - unidentified eubacterium SCB49 Length = 158 Score = 30.3 bits (65), Expect = 9.2 Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +2 Query: 215 LHHYRFSLVTSHVLTKTLCLLHNIFRPS-LGVSCALHFTFIGF 340 ++H++F L+TS + C+L P+ + ++ +H F GF Sbjct: 47 INHHQFKLITSEIGFGAFCVLEGTIEPNGVKITITIHKVFKGF 89 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 295,170,969 Number of Sequences: 1657284 Number of extensions: 4500415 Number of successful extensions: 9086 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 8508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9058 length of database: 575,637,011 effective HSP length: 89 effective length of database: 428,138,735 effective search space used: 10703468375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -