BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_F12 (388 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC110505-1|AAI10506.2| 917|Homo sapiens hexokinase domain conta... 29 4.0 BC110504-1|AAI10505.1| 917|Homo sapiens hexokinase domain conta... 29 4.0 BC021278-1|AAH21278.1| 427|Homo sapiens HKDC1 protein protein. 29 4.0 BC012337-1|AAH12337.1| 677|Homo sapiens HKDC1 protein protein. 29 4.0 AL596223-3|CAH71500.1| 917|Homo sapiens hexokinase domain conta... 29 4.0 >BC110505-1|AAI10506.2| 917|Homo sapiens hexokinase domain containing 1 protein. Length = 917 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = -1 Query: 358 RKDHGMRHIQEQLAVGNYLFPLCYHFPRIIDDLSQETVSSL 236 R+D G+ H++ + V L+ L HF RI+ QETV L Sbjct: 845 REDQGLEHLRITVGVDGTLYKLHPHFSRIL----QETVKEL 881 >BC110504-1|AAI10505.1| 917|Homo sapiens hexokinase domain containing 1 protein. Length = 917 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = -1 Query: 358 RKDHGMRHIQEQLAVGNYLFPLCYHFPRIIDDLSQETVSSL 236 R+D G+ H++ + V L+ L HF RI+ QETV L Sbjct: 845 REDQGLEHLRITVGVDGTLYKLHPHFSRIL----QETVKEL 881 >BC021278-1|AAH21278.1| 427|Homo sapiens HKDC1 protein protein. Length = 427 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = -1 Query: 358 RKDHGMRHIQEQLAVGNYLFPLCYHFPRIIDDLSQETVSSL 236 R+D G+ H++ + V L+ L HF RI+ QETV L Sbjct: 355 REDQGLEHLRITVGVDGTLYKLHPHFSRIL----QETVKEL 391 >BC012337-1|AAH12337.1| 677|Homo sapiens HKDC1 protein protein. Length = 677 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = -1 Query: 358 RKDHGMRHIQEQLAVGNYLFPLCYHFPRIIDDLSQETVSSL 236 R+D G+ H++ + V L+ L HF RI+ QETV L Sbjct: 605 REDQGLEHLRITVGVDGTLYKLHPHFSRIL----QETVKEL 641 >AL596223-3|CAH71500.1| 917|Homo sapiens hexokinase domain containing 1 protein. Length = 917 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = -1 Query: 358 RKDHGMRHIQEQLAVGNYLFPLCYHFPRIIDDLSQETVSSL 236 R+D G+ H++ + V L+ L HF RI+ QETV L Sbjct: 845 REDQGLEHLRITVGVDGTLYKLHPHFSRIL----QETVKEL 881 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 54,766,472 Number of Sequences: 237096 Number of extensions: 1093039 Number of successful extensions: 1722 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1672 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1722 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2641190740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -